BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0226 (736 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1002.19 |urg1||GTP cyclohydrolase II |Schizosaccharomyces po... 27 3.7 SPBC354.04 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 25 8.5 >SPAC1002.19 |urg1||GTP cyclohydrolase II |Schizosaccharomyces pombe|chr 1|||Manual Length = 439 Score = 26.6 bits (56), Expect = 3.7 Identities = 9/32 (28%), Positives = 23/32 (71%) Frame = -3 Query: 710 VYKRHLEKGYRLSPWVTPDQASVEVSKVKDMV 615 V+K++L++GY + P + +A ++V++++ V Sbjct: 139 VFKKYLDEGYDVRPTIAITRAHLQVTEIQRSV 170 >SPBC354.04 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 163 Score = 25.4 bits (53), Expect = 8.5 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = +3 Query: 264 DLLSSFDSDHVHAVLIS 314 +L++SFD DHV +L+S Sbjct: 65 ELMTSFDFDHVQQILLS 81 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,962,386 Number of Sequences: 5004 Number of extensions: 61382 Number of successful extensions: 156 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 150 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 156 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 347244562 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -