BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0225 (338 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0514 - 24477720-24479915 27 2.8 11_02_0038 - 7631462-7634428,7635975-7636250 27 2.8 08_02_0684 + 20031661-20031957,20032094-20032512,20033600-200336... 27 5.0 07_03_1670 - 28505732-28506426,28508202-28509309 27 5.0 02_05_1154 + 34506915-34507467,34508334-34508388,34508933-34509038 26 6.6 09_04_0327 + 16700235-16700312,16701756-16701978,16702488-167027... 26 8.7 06_03_1145 - 28000012-28000022,28000119-28000290,28000381-280004... 26 8.7 >11_06_0514 - 24477720-24479915 Length = 731 Score = 27.5 bits (58), Expect = 2.8 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 328 GCLVICPRATVCLRRLCASAMA 263 GC + C ++ CLR LC S+ A Sbjct: 522 GCCISCSSSSKCLRCLCVSSSA 543 >11_02_0038 - 7631462-7634428,7635975-7636250 Length = 1080 Score = 27.5 bits (58), Expect = 2.8 Identities = 15/46 (32%), Positives = 28/46 (60%), Gaps = 2/46 (4%) Frame = +1 Query: 73 LSYESSNLKRENQLYGLRVLCINFLIKM--IPLALFVLGAILATTE 204 L ++S N+K E ++ L+ + + K +PLA+ V+ ++LAT E Sbjct: 415 LLWKSMNIKEEKEVETLQHIGTKIVSKCGGLPLAIKVIASVLATKE 460 >08_02_0684 + 20031661-20031957,20032094-20032512,20033600-20033606, 20033905-20033982,20034086-20034121 Length = 278 Score = 26.6 bits (56), Expect = 5.0 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -2 Query: 337 AAGGCLVICPRATVCLRRLCASAMACFY 254 A G C +I P A + LRRL +A F+ Sbjct: 201 AVGHCCLIIPYAVLRLRRLARKKVASFF 228 >07_03_1670 - 28505732-28506426,28508202-28509309 Length = 600 Score = 26.6 bits (56), Expect = 5.0 Identities = 20/65 (30%), Positives = 30/65 (46%) Frame = +1 Query: 124 RVLCINFLIKMIPLALFVLGAILATTEGCGSRKQLLKSGGLTAYRNRPLRTHTTV*DRLL 303 R +C++ L + LA L +++ G + S T+Y RP + T DRL Sbjct: 78 RDVCVSTLSTIPNLARKPLRDVISEVVGRAASAVRASSSNCTSYLQRPRQLRTR--DRLA 135 Query: 304 LSDKL 318 LSD L Sbjct: 136 LSDCL 140 >02_05_1154 + 34506915-34507467,34508334-34508388,34508933-34509038 Length = 237 Score = 26.2 bits (55), Expect = 6.6 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -1 Query: 233 FNNCFLEPQPSVVARIAPKTNNAKGIILIKKFIHNTLRP 117 F CF P PS A +AP+ ++G + + H+ L P Sbjct: 78 FPRCFTPPAPSFSAGVAPEPAYSRG--KLYRLPHDPLHP 114 >09_04_0327 + 16700235-16700312,16701756-16701978,16702488-16702730, 16702815-16702865,16702965-16703225,16703319-16703371, 16703446-16703815,16703906-16704750 Length = 707 Score = 25.8 bits (54), Expect = 8.7 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +1 Query: 58 APYYILSYESSNLKRENQLYGLRVLCI 138 +PYYI+ + N ++ QL G VLCI Sbjct: 258 SPYYIVHFFLRNKRQGWQLLGGTVLCI 284 >06_03_1145 - 28000012-28000022,28000119-28000290,28000381-28000488, 28000578-28002152 Length = 621 Score = 25.8 bits (54), Expect = 8.7 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -3 Query: 63 WCSLVITKRSTFFLINLKF 7 WCSL K+ +F L+ LK+ Sbjct: 347 WCSLASEKQDSFRLVGLKY 365 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,389,666 Number of Sequences: 37544 Number of extensions: 141912 Number of successful extensions: 331 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 326 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 331 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 470052804 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -