BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0224 (639 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC336.11 |||GARP complex subunit Vps52 |Schizosaccharomyces po... 27 2.3 SPAC1556.06.1 |meu1|SPAC1556.06a, SPAC1556.06|sequence orphan|Sc... 25 7.0 >SPBC336.11 |||GARP complex subunit Vps52 |Schizosaccharomyces pombe|chr 2|||Manual Length = 508 Score = 27.1 bits (57), Expect = 2.3 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = +3 Query: 207 VTCIFSLRITCPYHTTYRFYLSIQKLSEKQFPRTFINVFSRVLH*AR 347 V C + L +T + Y F L LS+ Q F +F + LH +R Sbjct: 286 VYCSWELVLTEHVSSEYAFLLEYFNLSKDQQATVFAAIFEKTLHFSR 332 >SPAC1556.06.1 |meu1|SPAC1556.06a, SPAC1556.06|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 776 Score = 25.4 bits (53), Expect = 7.0 Identities = 14/49 (28%), Positives = 24/49 (48%) Frame = +2 Query: 284 KRKAVSQNLHKCLFASPALSQVFLEPLFLKIELVNFRSGLFCNFRKKIE 430 K +N KCL + ++ PL K+E++ + L +FRK +E Sbjct: 101 KENGTLKNEEKCLRMQIVAQEEYVAPLIQKLEIIEKK--LDKSFRKNME 147 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,265,125 Number of Sequences: 5004 Number of extensions: 41845 Number of successful extensions: 103 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 103 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 285732116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -