BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0222 (684 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 24 1.6 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 24 1.6 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 23 3.6 AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 prot... 23 3.6 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 3.6 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 22 4.7 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 22 6.3 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 21 8.3 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 21 8.3 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 21 8.3 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 23.8 bits (49), Expect = 1.6 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +2 Query: 167 DSDLQLERINVYYNEASGGKYVPRAILVDWSPAPWTLSAP 286 D+ L+ I Y N+ GG++V I W+P + + P Sbjct: 72 DARLKFSNIAPYLNQIYGGQFVRDLI---WTPTVYVSNEP 108 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 23.8 bits (49), Expect = 1.6 Identities = 7/20 (35%), Positives = 15/20 (75%) Frame = +1 Query: 388 VDSVLDVVRKESESCDCLQG 447 +DS+++++R ++CD L G Sbjct: 106 IDSIINIIRVRVDACDRLWG 125 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 22.6 bits (46), Expect = 3.6 Identities = 11/47 (23%), Positives = 24/47 (51%) Frame = +3 Query: 531 DRIMNTYSVVPSPKVSDTVVEPYNATLSVHQLVENTDKPTALTTRLY 671 D +++ Y+ + P +++T L + QL+E K +TT ++ Sbjct: 39 DDLLSNYNRLIRPVMNNTETLTVQLGLKLSQLIEMNLKNQVMTTNVW 85 >AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 protein. Length = 232 Score = 22.6 bits (46), Expect = 3.6 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -1 Query: 633 FQLAGELRESHCM 595 F G +RESHCM Sbjct: 68 FGCCGAIRESHCM 80 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.6 bits (46), Expect = 3.6 Identities = 17/58 (29%), Positives = 23/58 (39%) Frame = +2 Query: 410 SAKNQNLAIAYRASNLHIPSVAAPGPVWAPSSSKDP*RVPRQNHEHILSSPLAQSIRH 583 ++ + +L+ A S H P V + P S P Q H H SSP Q H Sbjct: 284 ASHHSHLSSALGRSACHSPGVYPSTAGFLPPSYHPHQHHPSQYHPHRGSSPHHQHGNH 341 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 22.2 bits (45), Expect = 4.7 Identities = 12/47 (25%), Positives = 23/47 (48%) Frame = +3 Query: 531 DRIMNTYSVVPSPKVSDTVVEPYNATLSVHQLVENTDKPTALTTRLY 671 D +++ Y+ + P V+ T L + QL++ K +TT L+ Sbjct: 30 DDLLSNYNKLVRPVVNVTDALTVKIKLKLSQLIDVNLKNQIMTTNLW 76 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -2 Query: 191 CAPTASQSPHGRHRWGRCRARQ 126 C+P Q+P R GR R R+ Sbjct: 392 CSPPPRQTPPSRKESGRRRRRR 413 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.4 bits (43), Expect = 8.3 Identities = 12/47 (25%), Positives = 24/47 (51%) Frame = +3 Query: 531 DRIMNTYSVVPSPKVSDTVVEPYNATLSVHQLVENTDKPTALTTRLY 671 D +++ Y+ + P V+ + V L + QL++ K +TT L+ Sbjct: 34 DDLLSNYNKLVRPVVNTSDVLRVCIKLKLSQLIDVNLKNQIMTTNLW 80 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.4 bits (43), Expect = 8.3 Identities = 12/47 (25%), Positives = 24/47 (51%) Frame = +3 Query: 531 DRIMNTYSVVPSPKVSDTVVEPYNATLSVHQLVENTDKPTALTTRLY 671 D +++ Y+ + P V+ + V L + QL++ K +TT L+ Sbjct: 34 DDLLSNYNKLVRPVVNTSDVLRVCIKLKLSQLIDVNLKNQIMTTNLW 80 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 21.4 bits (43), Expect = 8.3 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +3 Query: 609 LSVHQLVENTDKPTALTTRLYTT 677 LS+H +++ +K LTT + T Sbjct: 37 LSLHHIIDVDEKNQILTTNCWVT 59 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,934 Number of Sequences: 438 Number of extensions: 4476 Number of successful extensions: 15 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -