BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0218 (615 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 5e-16 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 2e-15 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 77 9e-15 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 77 1e-14 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 77 1e-14 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 77 1e-14 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 77 1e-14 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 77 1e-14 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 77 1e-14 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 77 1e-14 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 77 1e-14 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 77 1e-14 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 77 1e-14 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 77 1e-14 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 77 1e-14 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 77 1e-14 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 77 2e-14 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 2e-14 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 75 3e-14 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 3e-14 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 75 5e-14 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 75 5e-14 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 75 5e-14 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 75 5e-14 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 75 5e-14 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 75 5e-14 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 75 5e-14 SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) 75 5e-14 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) 75 5e-14 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 75 5e-14 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) 75 5e-14 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 75 5e-14 SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) 75 5e-14 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 75 5e-14 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 75 5e-14 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 75 5e-14 SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) 75 5e-14 SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 75 5e-14 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 75 5e-14 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) 75 5e-14 SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 75 5e-14 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 75 5e-14 SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 75 5e-14 SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 75 5e-14 SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) 75 5e-14 SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 75 5e-14 SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) 75 5e-14 SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 75 5e-14 SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 75 5e-14 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 75 5e-14 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 75 5e-14 SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 75 5e-14 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) 75 5e-14 SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 75 5e-14 SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 75 5e-14 SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) 75 5e-14 SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 75 5e-14 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 75 5e-14 SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 75 5e-14 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 75 5e-14 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 75 5e-14 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) 75 5e-14 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 75 5e-14 SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 75 5e-14 SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 75 5e-14 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 75 5e-14 SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) 75 5e-14 SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 75 5e-14 SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 75 5e-14 SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_35131| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_34873| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 75 5e-14 SB_34216| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 75 5e-14 SB_33422| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_33231| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_32024| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_31980| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_31481| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_31350| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_30835| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 75 5e-14 SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) 75 5e-14 SB_30218| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_29409| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_29177| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_28808| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_28480| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_26038| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_25820| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_25742| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_25630| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_24684| Best HMM Match : Phage_rep_O (HMM E-Value=2.3) 75 5e-14 SB_24127| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 75 5e-14 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 75 5e-14 SB_23282| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_22993| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 75 5e-14 SB_21177| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 75 5e-14 SB_20277| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_19885| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 75 5e-14 SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_17265| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_16846| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_16672| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_16494| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_16270| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_16198| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_15539| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_14857| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_14581| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_14087| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_13215| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_12828| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_12518| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 75 5e-14 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_11228| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_11209| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_11018| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_10523| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_10150| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2) 75 5e-14 SB_9090| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_8817| Best HMM Match : I-set (HMM E-Value=0) 75 5e-14 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_7590| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_7267| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_6665| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_6263| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 75 5e-14 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 75 5e-14 SB_4702| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_4674| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 75 5e-14 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_4402| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_4342| Best HMM Match : KA1 (HMM E-Value=0.53) 75 5e-14 SB_2432| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_2348| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_2263| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_1977| Best HMM Match : Filament_head (HMM E-Value=4.2) 75 5e-14 SB_1945| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_1808| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_1403| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_1099| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_938| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_758| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_357| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 1e-13 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 73 1e-13 SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 1e-13 SB_55182| Best HMM Match : T4_deiodinase (HMM E-Value=0) 73 1e-13 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 73 1e-13 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 1e-13 SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) 73 1e-13 SB_29477| Best HMM Match : Antistasin (HMM E-Value=9.2) 73 2e-13 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 72 4e-13 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_46862| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 71 7e-13 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_15928| Best HMM Match : BA14K (HMM E-Value=7) 71 7e-13 SB_51749| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_51748| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 70 2e-12 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 70 2e-12 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 70 2e-12 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 70 2e-12 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 70 2e-12 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 70 2e-12 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 70 2e-12 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 70 2e-12 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 70 2e-12 SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 70 2e-12 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_25275| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_24506| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_23850| Best HMM Match : SMP (HMM E-Value=4.9) 70 2e-12 SB_23569| Best HMM Match : PAN (HMM E-Value=0.0015) 70 2e-12 SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_23208| Best HMM Match : X_fast-SP_rel (HMM E-Value=6.6) 70 2e-12 SB_23034| Best HMM Match : Cyclotide (HMM E-Value=3.9) 70 2e-12 SB_22912| Best HMM Match : Adeno_VII (HMM E-Value=7.6) 70 2e-12 SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5) 70 2e-12 SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_22390| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) 70 2e-12 SB_21857| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_21818| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_21155| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_21127| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_21113| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_20330| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_19225| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_17851| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_17584| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_17547| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_17396| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_17369| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_17253| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_16189| Best HMM Match : rve (HMM E-Value=0.3) 70 2e-12 SB_16111| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_15999| Best HMM Match : LRR_1 (HMM E-Value=1.7e-21) 70 2e-12 SB_15725| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_15560| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_15427| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_15387| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_14378| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_14278| Best HMM Match : DUF1328 (HMM E-Value=6.3) 70 2e-12 SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_13592| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_13284| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_12434| Best HMM Match : SAB (HMM E-Value=4.6) 70 2e-12 SB_12355| Best HMM Match : IncA (HMM E-Value=2) 70 2e-12 SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_12058| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_11542| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 81.4 bits (192), Expect = 5e-16 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = +2 Query: 482 NSPYSESYYIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGV 607 NSPY IHWPSFYNVVTGKTLALPNLIALQHIPLSPAG+ Sbjct: 75 NSPYMSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGL 116 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 79.4 bits (187), Expect = 2e-15 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASECNTT 498 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE N + Sbjct: 235 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASELNVS 273 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 77.4 bits (182), Expect = 9e-15 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASECNTTHYR 489 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE + R Sbjct: 132 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASELTGSKQR 173 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 22 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 56 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 234 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 268 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 902 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 936 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 49 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 14 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 48 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 389 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 423 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 238 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 272 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 305 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 339 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 371 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 405 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 63 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 97 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 22 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 56 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 22 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 56 Score = 68.9 bits (161), Expect = 3e-12 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +1 Query: 529 QRRDWENPGVTQLNRLAAHPPFASWRNNE 615 QRRDWENPGVTQLNRLAAHPPFASWRN+E Sbjct: 90 QRRDWENPGVTQLNRLAAHPPFASWRNSE 118 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 49 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 49 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 22 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 56 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 22 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 56 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 45 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 79 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 281 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 315 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 265 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 299 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 49 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 544 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 578 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 254 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 288 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 279 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 313 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 463 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 497 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 298 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 332 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 148 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 182 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 22 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 56 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 22 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 56 >SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 8 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 42 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 207 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 241 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 599 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 633 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 547 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 96 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 130 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 404 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 438 >SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 8 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 42 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 77.0 bits (181), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 197 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 231 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 76.6 bits (180), Expect = 2e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +2 Query: 509 IHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVI 610 IHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVI Sbjct: 6 IHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVI 39 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 76.2 bits (179), Expect = 2e-14 Identities = 34/45 (75%), Positives = 34/45 (75%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASECNTTHYRANW 480 SLLRQLAKGGCAARRLSWVTPGF K CNTTHYRANW Sbjct: 36 SLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) Length = 631 Score = 75.4 bits (177), Expect = 3e-14 Identities = 37/50 (74%), Positives = 38/50 (76%), Gaps = 3/50 (6%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS---ECNTTHYRANWVP 474 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS C W+P Sbjct: 464 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVGGSLKWLP 513 >SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 75.4 bits (177), Expect = 3e-14 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 510 SLLRQL KGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 341 SLLRQLVKGGCAARRLSWVTPGFSQSRRCKTTASE 375 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 490 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 523 >SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) Length = 212 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 160 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 193 >SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 237 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 270 >SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 381 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 414 >SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 83 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 116 >SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 664 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 697 >SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) Length = 388 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) Length = 305 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) Length = 154 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 573 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 606 >SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) Length = 666 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 420 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 453 >SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) Length = 128 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) Length = 794 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 47 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 80 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 803 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 836 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 83 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 116 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 29 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) Length = 214 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 534 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 385 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 418 >SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) Length = 1232 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 1119 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 1152 >SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) Length = 412 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 310 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 343 >SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1758 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 124 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 157 >SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 34 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 >SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 41 >SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) Length = 466 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 50 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 83 >SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 29 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) Length = 742 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 500 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 533 >SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) Length = 184 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 108 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 141 >SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 68 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 101 >SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 70 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 103 >SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 64 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 97 >SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) Length = 90 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) Length = 542 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 169 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 202 >SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) Length = 546 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 29 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) Length = 220 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) Length = 316 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 206 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 239 >SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 142 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 175 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) Length = 250 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) Length = 283 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 113 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 146 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 849 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 69 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 102 >SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) Length = 144 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) Length = 128 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 41 >SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 74.9 bits (176), Expect = 5e-14 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 509 IHWPSFYNVVTGKTLALPNLIALQHIPLSPAGV 607 IHWPSFYNVVTGKTLALPNLIALQHIPLSPAGV Sbjct: 6 IHWPSFYNVVTGKTLALPNLIALQHIPLSPAGV 38 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 29 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) Length = 199 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 41 >SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) Length = 206 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) Length = 229 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) Length = 164 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 506 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 126 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 159 >SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) Length = 130 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_35131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_34873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) Length = 206 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1411 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) Length = 1106 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 932 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 965 >SB_33422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_33231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 74.9 bits (176), Expect = 5e-14 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 512 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVI 610 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVI Sbjct: 62 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVI 94 >SB_32024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_31980| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 74.9 bits (176), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 614 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,387,620 Number of Sequences: 59808 Number of extensions: 318017 Number of successful extensions: 6447 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4687 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6435 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1512078125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -