BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0216 (739 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0084 - 573638-574305,574705-574900,574997-577246,578053-57... 29 2.9 03_03_0101 - 14431327-14432390,14432599-14432731 28 8.9 >02_01_0084 - 573638-574305,574705-574900,574997-577246,578053-579174, 579266-579370,579975-580028,580244-580344,580454-581423, 582030-582203,582341-582643,582719-582856,582993-583247, 584230-584370,585008-585289,585395-585540,585627-585690, 585723-585799,586285-586301,587728-587867,587972-588029, 588121-588218,588727-588776,589260-589743 Length = 2630 Score = 29.5 bits (63), Expect = 2.9 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = +1 Query: 70 KYYKNLGCLIKNAKRKKHLVEHEQE-EKQWDLLDNYMVAEDPFLGPGKNQKLTLFKEI 240 K+ N+ + KRK+ LVE+ QE EK D+ + ED F + + T+++++ Sbjct: 2330 KHTSNVLSKVHEQKRKQLLVEYNQEMEKLKQKYDSLLQKEDSFYAQKEAELDTIYRKV 2387 >03_03_0101 - 14431327-14432390,14432599-14432731 Length = 398 Score = 27.9 bits (59), Expect = 8.9 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +2 Query: 602 RVIWENFYKPIVYIGTNSAEEEEILIE 682 R+ W N+ +P + GT S EEE+++I+ Sbjct: 54 RLRWINYLRPDLKRGTFSQEEEDLIIQ 80 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,743,964 Number of Sequences: 37544 Number of extensions: 516353 Number of successful extensions: 1333 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1290 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1333 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1945321620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -