BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0214 (615 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y13472-1|CAA73875.1| 1379|Homo sapiens FIM protein protein. 31 3.2 BC036372-1|AAH36372.1| 1377|Homo sapiens zinc finger, MYM-type 2... 31 3.2 AL138688-3|CAH71823.1| 755|Homo sapiens zinc finger, MYM-type 2... 31 3.2 AL138688-1|CAH71822.1| 1375|Homo sapiens zinc finger, MYM-type 2... 31 3.2 AL137119-3|CAH70135.1| 755|Homo sapiens zinc finger, MYM-type 2... 31 3.2 AL137119-1|CAH70133.1| 1375|Homo sapiens zinc finger, MYM-type 2... 31 3.2 AJ224901-1|CAA12204.1| 1377|Homo sapiens ZNF198 protein protein. 31 3.2 AJ007676-1|CAA07604.1| 1377|Homo sapiens ZNF198 protein protein. 31 3.2 AF060181-1|AAC23591.1| 1113|Homo sapiens zinc finger protein pro... 31 3.2 AF035374-1|AAB88464.1| 699|Homo sapiens Cys-rich protein protein. 31 3.2 AF012126-1|AAC01561.1| 757|Homo sapiens zinc finger protein pro... 31 3.2 BC125129-1|AAI25130.1| 892|Homo sapiens zinc finger protein 512... 29 9.9 BC125128-1|AAI25129.1| 892|Homo sapiens zinc finger protein 512... 29 9.9 BC036422-1|AAH36422.1| 436|Homo sapiens hypothetical protein MG... 29 9.9 AL118506-12|CAC15498.3| 892|Homo sapiens RP4-591C20.6 protein. 29 9.9 AB033022-1|BAA86510.1| 851|Homo sapiens KIAA1196 protein protein. 29 9.9 >Y13472-1|CAA73875.1| 1379|Homo sapiens FIM protein protein. Length = 1379 Score = 31.1 bits (67), Expect = 3.2 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Frame = -3 Query: 544 RSHQENPLHRREKVPYEVKVPIDKPYPVY---KEVQVPLVKEVPYPVKYHVP 398 +S Q + R E VP + VP+ P P++ + + VP VP PV +P Sbjct: 872 KSCQTDDTWRTEYVPVPIPVPVYIPVPMHMYSQNIPVPTTVPVPVPVPVFLP 923 >BC036372-1|AAH36372.1| 1377|Homo sapiens zinc finger, MYM-type 2 protein. Length = 1377 Score = 31.1 bits (67), Expect = 3.2 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Frame = -3 Query: 544 RSHQENPLHRREKVPYEVKVPIDKPYPVY---KEVQVPLVKEVPYPVKYHVP 398 +S Q + R E VP + VP+ P P++ + + VP VP PV +P Sbjct: 870 KSCQTDDTWRTEYVPVPIPVPVYIPVPMHMYSQNIPVPTTVPVPVPVPVFLP 921 >AL138688-3|CAH71823.1| 755|Homo sapiens zinc finger, MYM-type 2 protein. Length = 755 Score = 31.1 bits (67), Expect = 3.2 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Frame = -3 Query: 544 RSHQENPLHRREKVPYEVKVPIDKPYPVY---KEVQVPLVKEVPYPVKYHVP 398 +S Q + R E VP + VP+ P P++ + + VP VP PV +P Sbjct: 248 KSCQTDDTWRTEYVPVPIPVPVYIPVPMHMYSQNIPVPTTVPVPVPVPVFLP 299 >AL138688-1|CAH71822.1| 1375|Homo sapiens zinc finger, MYM-type 2 protein. Length = 1375 Score = 31.1 bits (67), Expect = 3.2 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Frame = -3 Query: 544 RSHQENPLHRREKVPYEVKVPIDKPYPVY---KEVQVPLVKEVPYPVKYHVP 398 +S Q + R E VP + VP+ P P++ + + VP VP PV +P Sbjct: 868 KSCQTDDTWRTEYVPVPIPVPVYIPVPMHMYSQNIPVPTTVPVPVPVPVFLP 919 >AL137119-3|CAH70135.1| 755|Homo sapiens zinc finger, MYM-type 2 protein. Length = 755 Score = 31.1 bits (67), Expect = 3.2 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Frame = -3 Query: 544 RSHQENPLHRREKVPYEVKVPIDKPYPVY---KEVQVPLVKEVPYPVKYHVP 398 +S Q + R E VP + VP+ P P++ + + VP VP PV +P Sbjct: 248 KSCQTDDTWRTEYVPVPIPVPVYIPVPMHMYSQNIPVPTTVPVPVPVPVFLP 299 >AL137119-1|CAH70133.1| 1375|Homo sapiens zinc finger, MYM-type 2 protein. Length = 1375 Score = 31.1 bits (67), Expect = 3.2 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Frame = -3 Query: 544 RSHQENPLHRREKVPYEVKVPIDKPYPVY---KEVQVPLVKEVPYPVKYHVP 398 +S Q + R E VP + VP+ P P++ + + VP VP PV +P Sbjct: 868 KSCQTDDTWRTEYVPVPIPVPVYIPVPMHMYSQNIPVPTTVPVPVPVPVFLP 919 >AJ224901-1|CAA12204.1| 1377|Homo sapiens ZNF198 protein protein. Length = 1377 Score = 31.1 bits (67), Expect = 3.2 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Frame = -3 Query: 544 RSHQENPLHRREKVPYEVKVPIDKPYPVY---KEVQVPLVKEVPYPVKYHVP 398 +S Q + R E VP + VP+ P P++ + + VP VP PV +P Sbjct: 870 KSCQTDDTWRTEYVPVPIPVPVYIPVPMHMYSQNIPVPTTVPVPVPVPVFLP 921 >AJ007676-1|CAA07604.1| 1377|Homo sapiens ZNF198 protein protein. Length = 1377 Score = 31.1 bits (67), Expect = 3.2 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Frame = -3 Query: 544 RSHQENPLHRREKVPYEVKVPIDKPYPVY---KEVQVPLVKEVPYPVKYHVP 398 +S Q + R E VP + VP+ P P++ + + VP VP PV +P Sbjct: 870 KSCQTDDTWRTEYVPVPIPVPVYIPVPMHMYSQNIPVPTTVPVPVPVPVFLP 921 >AF060181-1|AAC23591.1| 1113|Homo sapiens zinc finger protein protein. Length = 1113 Score = 31.1 bits (67), Expect = 3.2 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Frame = -3 Query: 544 RSHQENPLHRREKVPYEVKVPIDKPYPVY---KEVQVPLVKEVPYPVKYHVP 398 +S Q + R E VP + VP+ P P++ + + VP VP PV +P Sbjct: 606 KSCQTDDTWRTEYVPVPIPVPVYIPVPMHMYSQNIPVPTTVPVPVPVPVFLP 657 >AF035374-1|AAB88464.1| 699|Homo sapiens Cys-rich protein protein. Length = 699 Score = 31.1 bits (67), Expect = 3.2 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Frame = -3 Query: 544 RSHQENPLHRREKVPYEVKVPIDKPYPVY---KEVQVPLVKEVPYPVKYHVP 398 +S Q + R E VP + VP+ P P++ + + VP VP PV +P Sbjct: 598 KSCQTDDTWRTEYVPVPIPVPVYIPVPMHMYSQNIPVPTTVPVPVPVPVFLP 649 >AF012126-1|AAC01561.1| 757|Homo sapiens zinc finger protein protein. Length = 757 Score = 31.1 bits (67), Expect = 3.2 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Frame = -3 Query: 544 RSHQENPLHRREKVPYEVKVPIDKPYPVY---KEVQVPLVKEVPYPVKYHVP 398 +S Q + R E VP + VP+ P P++ + + VP VP PV +P Sbjct: 250 KSCQTDDTWRTEYVPVPIPVPVYIPVPMHMYSQNIPVPTTVPVPVPVPVFLP 301 >BC125129-1|AAI25130.1| 892|Homo sapiens zinc finger protein 512B protein. Length = 892 Score = 29.5 bits (63), Expect = 9.9 Identities = 22/69 (31%), Positives = 32/69 (46%), Gaps = 4/69 (5%) Frame = -3 Query: 589 EALPGPR*SASTKPLRSHQENPLHRREKV--PYEV--KVPIDKPYPVYKEVQVPLVKEVP 422 +A+P R TKP+ + P+ + V P V VP+ KP PV K + V + V Sbjct: 226 KAIPVTRPVPVTKPVTVSRPMPVTKAMPVTKPITVTKSVPVTKPVPVTKPITVTKLVTVT 285 Query: 421 YPVKYHVPI 395 PV P+ Sbjct: 286 KPVPVTKPV 294 >BC125128-1|AAI25129.1| 892|Homo sapiens zinc finger protein 512B protein. Length = 892 Score = 29.5 bits (63), Expect = 9.9 Identities = 22/69 (31%), Positives = 32/69 (46%), Gaps = 4/69 (5%) Frame = -3 Query: 589 EALPGPR*SASTKPLRSHQENPLHRREKV--PYEV--KVPIDKPYPVYKEVQVPLVKEVP 422 +A+P R TKP+ + P+ + V P V VP+ KP PV K + V + V Sbjct: 226 KAIPVTRPVPVTKPVTVSRPMPVTKAMPVTKPITVTKSVPVTKPVPVTKPITVTKLVTVT 285 Query: 421 YPVKYHVPI 395 PV P+ Sbjct: 286 KPVPVTKPV 294 >BC036422-1|AAH36422.1| 436|Homo sapiens hypothetical protein MGC42105 protein. Length = 436 Score = 29.5 bits (63), Expect = 9.9 Identities = 12/34 (35%), Positives = 24/34 (70%) Frame = +3 Query: 108 ITTQLRVSETNSRDLYTRENVALNNAHNNQLIHR 209 I+T+ ++SE S+ ++++ A+ + H NQ+IHR Sbjct: 162 ISTEGKLSEPESKLIFSQIVSAVKHMHENQIIHR 195 >AL118506-12|CAC15498.3| 892|Homo sapiens RP4-591C20.6 protein. Length = 892 Score = 29.5 bits (63), Expect = 9.9 Identities = 22/69 (31%), Positives = 32/69 (46%), Gaps = 4/69 (5%) Frame = -3 Query: 589 EALPGPR*SASTKPLRSHQENPLHRREKV--PYEV--KVPIDKPYPVYKEVQVPLVKEVP 422 +A+P R TKP+ + P+ + V P V VP+ KP PV K + V + V Sbjct: 226 KAIPVTRPVPVTKPVTVSRPMPVTKAMPVTKPITVTKSVPVTKPVPVTKPITVTKLVTVT 285 Query: 421 YPVKYHVPI 395 PV P+ Sbjct: 286 KPVPVTKPV 294 >AB033022-1|BAA86510.1| 851|Homo sapiens KIAA1196 protein protein. Length = 851 Score = 29.5 bits (63), Expect = 9.9 Identities = 22/69 (31%), Positives = 32/69 (46%), Gaps = 4/69 (5%) Frame = -3 Query: 589 EALPGPR*SASTKPLRSHQENPLHRREKV--PYEV--KVPIDKPYPVYKEVQVPLVKEVP 422 +A+P R TKP+ + P+ + V P V VP+ KP PV K + V + V Sbjct: 185 KAIPVTRPVPVTKPVTVSRPMPVTKAMPVTKPITVTKSVPVTKPVPVTKPITVTKLVTVT 244 Query: 421 YPVKYHVPI 395 PV P+ Sbjct: 245 KPVPVTKPV 253 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 74,154,648 Number of Sequences: 237096 Number of extensions: 1445447 Number of successful extensions: 10674 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 10506 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10654 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6579110070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -