BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0207 (713 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58198| Best HMM Match : Exo_endo_phos (HMM E-Value=0.012) 42 7e-04 SB_50550| Best HMM Match : RVT_1 (HMM E-Value=7.5e-28) 41 9e-04 SB_26710| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_52619| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_51640| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_46263| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) 40 0.003 SB_1034| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) 40 0.003 SB_30215| Best HMM Match : RVT_1 (HMM E-Value=2.6e-34) 39 0.003 SB_47464| Best HMM Match : RVT_1 (HMM E-Value=0.012) 39 0.005 SB_41708| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_42669| Best HMM Match : Sorb (HMM E-Value=9.2) 38 0.008 SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) 38 0.008 SB_35509| Best HMM Match : Sorb (HMM E-Value=9.2) 38 0.011 SB_33398| Best HMM Match : Sorb (HMM E-Value=9.9) 38 0.011 SB_33087| Best HMM Match : Fascin (HMM E-Value=8.9) 38 0.011 SB_30852| Best HMM Match : RVT_1 (HMM E-Value=0) 38 0.011 SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) 38 0.011 SB_22818| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_22717| Best HMM Match : RuvA_C (HMM E-Value=7) 38 0.011 SB_18662| Best HMM Match : Toxin_27 (HMM E-Value=2) 38 0.011 SB_57819| Best HMM Match : Sorb (HMM E-Value=9.2) 38 0.011 SB_54752| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_51255| Best HMM Match : Sorb (HMM E-Value=9.2) 38 0.011 SB_47529| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_36813| Best HMM Match : RVT_1 (HMM E-Value=1.4e-14) 38 0.011 SB_22738| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_20783| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_14288| Best HMM Match : Sorb (HMM E-Value=9.9) 38 0.011 SB_10251| Best HMM Match : RVT_1 (HMM E-Value=0.0022) 38 0.011 SB_9596| Best HMM Match : BAF (HMM E-Value=1.54143e-44) 38 0.011 SB_7670| Best HMM Match : Sorb (HMM E-Value=9.2) 38 0.011 SB_3943| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_63| Best HMM Match : RVT_1 (HMM E-Value=0) 38 0.011 SB_18451| Best HMM Match : Sorb (HMM E-Value=9.2) 37 0.014 SB_43536| Best HMM Match : DUF1410 (HMM E-Value=3.5) 37 0.014 SB_56417| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_34112| Best HMM Match : RVT_1 (HMM E-Value=0.041) 37 0.019 SB_42738| Best HMM Match : 7tm_1 (HMM E-Value=0.89) 37 0.019 SB_30760| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_16492| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_6581| Best HMM Match : HEAT (HMM E-Value=3e-05) 37 0.019 SB_4883| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_54561| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_9025| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_12628| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_6740| Best HMM Match : RVT_1 (HMM E-Value=4.5e-22) 36 0.025 SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1) 36 0.033 SB_14726| Best HMM Match : Ribosomal_L30 (HMM E-Value=6.6) 36 0.043 SB_48112| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.043 SB_10495| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.043 SB_57037| Best HMM Match : RVT_1 (HMM E-Value=3.4e-15) 35 0.057 SB_56220| Best HMM Match : RVT_1 (HMM E-Value=3.7e-16) 35 0.057 SB_40620| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.057 SB_34116| Best HMM Match : RVT_1 (HMM E-Value=0) 35 0.057 SB_33284| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.057 SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40) 35 0.057 SB_26992| Best HMM Match : rve (HMM E-Value=6.3e-36) 35 0.057 SB_22251| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.057 SB_51232| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.057 SB_23276| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.057 SB_11067| Best HMM Match : RVT_1 (HMM E-Value=0) 35 0.057 SB_5024| Best HMM Match : rve (HMM E-Value=6.3e-36) 35 0.057 SB_58751| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.075 SB_57671| Best HMM Match : RVT_1 (HMM E-Value=0) 35 0.075 SB_53749| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.075 SB_53367| Best HMM Match : RVT_1 (HMM E-Value=0) 35 0.075 SB_12291| Best HMM Match : Exo_endo_phos (HMM E-Value=1.8e-09) 35 0.075 SB_49175| Best HMM Match : RVT_1 (HMM E-Value=1.8e-32) 35 0.075 SB_35779| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.075 SB_30161| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.075 SB_25515| Best HMM Match : Complex1_LYR (HMM E-Value=9.6) 35 0.075 SB_11838| Best HMM Match : RVT_1 (HMM E-Value=0) 35 0.075 SB_11114| Best HMM Match : UPF0203 (HMM E-Value=9.6) 35 0.075 SB_17007| Best HMM Match : VWA (HMM E-Value=4.6e-06) 34 0.100 SB_58989| Best HMM Match : RVT_1 (HMM E-Value=0) 34 0.100 SB_29819| Best HMM Match : Ribosomal_L39 (HMM E-Value=4.1) 34 0.100 SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) 34 0.13 SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) 34 0.13 SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) 34 0.13 SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0) 34 0.13 SB_462| Best HMM Match : RVT_1 (HMM E-Value=7.7e-25) 34 0.13 SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) 34 0.13 SB_40765| Best HMM Match : DX (HMM E-Value=1.4) 34 0.13 SB_38808| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_29272| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) 34 0.13 SB_18871| Best HMM Match : RVT_1 (HMM E-Value=0) 34 0.13 SB_14841| Best HMM Match : RVT_1 (HMM E-Value=0) 34 0.13 SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_43828| Best HMM Match : XPG_N (HMM E-Value=1.8) 33 0.23 SB_10379| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_9857| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_51699| Best HMM Match : SAM_2 (HMM E-Value=1.5) 33 0.30 SB_36728| Best HMM Match : ArsD (HMM E-Value=1.6) 33 0.30 SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_47667| Best HMM Match : Ldl_recept_a (HMM E-Value=0) 32 0.40 SB_31373| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) 32 0.40 SB_30049| Best HMM Match : FBA_2 (HMM E-Value=7) 32 0.40 SB_27524| Best HMM Match : RVT_1 (HMM E-Value=1.30321e-43) 32 0.40 SB_24320| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_24260| Best HMM Match : Rotavirus_VP7 (HMM E-Value=7.7) 32 0.40 SB_12986| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_7633| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_7040| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_51096| Best HMM Match : Baculo_ME53 (HMM E-Value=5.6) 32 0.40 SB_41403| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_18362| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) 32 0.40 SB_17278| Best HMM Match : RVT_1 (HMM E-Value=0.0082) 32 0.40 SB_17216| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27) 32 0.40 SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39) 32 0.40 SB_6674| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_2851| Best HMM Match : RVT_1 (HMM E-Value=3.50325e-43) 32 0.40 SB_51388| Best HMM Match : RVT_1 (HMM E-Value=0) 32 0.53 SB_27537| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.53 SB_17181| Best HMM Match : RVT_1 (HMM E-Value=0) 32 0.53 SB_4935| Best HMM Match : Pox_F16 (HMM E-Value=5.3) 32 0.53 SB_51961| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.53 SB_51257| Best HMM Match : Pox_F16 (HMM E-Value=4.1) 32 0.53 SB_43623| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.53 SB_33578| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00076) 32 0.53 SB_33076| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) 32 0.53 SB_10962| Best HMM Match : PHD (HMM E-Value=5.3e-05) 32 0.53 SB_8501| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.70 SB_51996| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.70 SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.70 SB_4548| Best HMM Match : WD40 (HMM E-Value=6.7e-35) 31 0.70 SB_59792| Best HMM Match : RVT_1 (HMM E-Value=4.2039e-45) 31 0.93 SB_51588| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_42960| Best HMM Match : RVT_1 (HMM E-Value=2.38221e-44) 31 0.93 SB_40301| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_24880| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_7292| Best HMM Match : RVT_1 (HMM E-Value=0) 31 0.93 SB_2407| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_49613| Best HMM Match : Transposase_5 (HMM E-Value=0.033) 31 0.93 SB_45340| Best HMM Match : RVT_1 (HMM E-Value=1.2e-15) 31 0.93 SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23) 31 0.93 SB_39321| Best HMM Match : RVT_1 (HMM E-Value=4.5e-39) 31 0.93 SB_38334| Best HMM Match : RVT_1 (HMM E-Value=5.60519e-45) 31 0.93 SB_33045| Best HMM Match : RVT_1 (HMM E-Value=3.4e-18) 31 0.93 SB_41746| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_37654| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_31120| Best HMM Match : Pox_F16 (HMM E-Value=5) 31 1.2 SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_19530| Best HMM Match : EMI (HMM E-Value=3.5) 31 1.2 SB_51544| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_22968| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28) 31 1.2 SB_14835| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) 30 1.6 SB_24457| Best HMM Match : TPR_2 (HMM E-Value=1.4e-16) 30 2.1 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 30 2.1 SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0) 30 2.1 SB_28404| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_26110| Best HMM Match : HipA_C (HMM E-Value=5.5) 30 2.1 SB_25497| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_24153| Best HMM Match : I_LWEQ (HMM E-Value=0.44) 30 2.1 SB_14729| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_10258| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_2458| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_56295| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_30264| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_25119| Best HMM Match : Ribosomal_S27 (HMM E-Value=9.4) 29 2.8 SB_36259| Best HMM Match : PHD (HMM E-Value=5.3e-05) 29 3.7 SB_43036| Best HMM Match : Chorion_3 (HMM E-Value=1.6) 29 3.7 SB_23862| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_9412| Best HMM Match : Peptidase_M1 (HMM E-Value=3.1e-07) 29 4.9 SB_2368| Best HMM Match : Patched (HMM E-Value=8.6e-08) 29 4.9 SB_59170| Best HMM Match : RVT_1 (HMM E-Value=0.13) 28 6.5 SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_42059| Best HMM Match : RVT_1 (HMM E-Value=0.0011) 28 6.5 SB_35764| Best HMM Match : RVT_1 (HMM E-Value=8.1e-13) 28 6.5 SB_35675| Best HMM Match : TB (HMM E-Value=8.4) 28 6.5 SB_28392| Best HMM Match : Exo_endo_phos (HMM E-Value=0.77) 28 6.5 SB_26687| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_21705| Best HMM Match : Sorb (HMM E-Value=9.2) 28 6.5 SB_18309| Best HMM Match : Exo_endo_phos (HMM E-Value=2.3e-09) 28 6.5 SB_38708| Best HMM Match : p450 (HMM E-Value=1.4) 28 6.5 SB_33858| Best HMM Match : RVT_1 (HMM E-Value=3.7e-21) 28 6.5 SB_27893| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_25427| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_22824| Best HMM Match : Herpes_gI (HMM E-Value=1.8) 28 6.5 SB_15890| Best HMM Match : ArsC (HMM E-Value=0.94) 28 6.5 SB_38681| Best HMM Match : RVT_1 (HMM E-Value=0.0082) 28 8.6 SB_33307| Best HMM Match : NAF1 (HMM E-Value=1.5e-18) 28 8.6 SB_23460| Best HMM Match : 7tm_1 (HMM E-Value=0.44) 28 8.6 SB_22775| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_20797| Best HMM Match : SoxE (HMM E-Value=0.046) 28 8.6 SB_18090| Best HMM Match : RVT_1 (HMM E-Value=0.59) 28 8.6 SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30) 28 8.6 SB_51268| Best HMM Match : SAP (HMM E-Value=2.3) 28 8.6 SB_32257| Best HMM Match : Sorb (HMM E-Value=5.7) 28 8.6 SB_26251| Best HMM Match : RVT_1 (HMM E-Value=0.0014) 28 8.6 SB_10275| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_222| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 >SB_58198| Best HMM Match : Exo_endo_phos (HMM E-Value=0.012) Length = 816 Score = 41.5 bits (93), Expect = 7e-04 Identities = 22/65 (33%), Positives = 30/65 (46%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 G ++ + H+ K + L R KRV+ T V LYK V P ++YC L Sbjct: 679 GVTLDSSLTYKEHITTVLKKVYAKVAALRRIKRVVPIQTMVALYKTYVLPHLEYCCPLLL 738 Query: 520 GAPKT 506 GA KT Sbjct: 739 GATKT 743 >SB_50550| Best HMM Match : RVT_1 (HMM E-Value=7.5e-28) Length = 434 Score = 41.1 bits (92), Expect = 9e-04 Identities = 18/59 (30%), Positives = 30/59 (50%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 G ++ F H+ K A + +GVL R + ++ K++LYK+ V P + YC W Sbjct: 310 GVTIDSQLNFSEHISIACKNAGRRIGVLMRLRNLIPTNAKLVLYKSAVLPYLTYCHLTW 368 >SB_26710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/65 (32%), Positives = 30/65 (46%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 G ++ + H+ K + L R KR++ T V LYK V P ++YC L Sbjct: 135 GVTMDSSLSYKRHISTALKKVYAKVAALRRIKRLVPIQTMVALYKTYVVPHLEYCFPLLL 194 Query: 520 GAPKT 506 GA KT Sbjct: 195 GATKT 199 >SB_52619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 492 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/65 (30%), Positives = 31/65 (47%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 G ++ + H+ K + L R KR++ T V LY+ + P ++YCS L Sbjct: 291 GVTLDSSLTYKEHITTVLKKVYAKVAALRRIKRLVPIQTMVALYRTYLLPHLEYCSPLLL 350 Query: 520 GAPKT 506 GA KT Sbjct: 351 GATKT 355 >SB_51640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 880 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/50 (34%), Positives = 28/50 (56%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 F H+ K AS+ +GVL R + ++ K+ LYK+ + P + YC +W Sbjct: 734 FSLHISEICKKASQKVGVLVRLRNLIPVDAKLQLYKSAILPNLTYCHTVW 783 >SB_46263| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) Length = 490 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/50 (34%), Positives = 28/50 (56%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 F H+ K AS+ +GVL R + ++ K+ LYK+ + P + YC +W Sbjct: 363 FSLHISEICKKASQKVGVLVRLRNLIPVDAKLQLYKSAILPNLTYCHTVW 412 >SB_1034| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) Length = 558 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/50 (34%), Positives = 28/50 (56%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 F H+ K AS+ +GVL R + ++ K+ LYK+ + P + YC +W Sbjct: 363 FSLHISEICKKASQKVGVLVRLRNLIPVDAKLQLYKSAILPNLTYCHTVW 412 >SB_30215| Best HMM Match : RVT_1 (HMM E-Value=2.6e-34) Length = 875 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/59 (27%), Positives = 29/59 (49%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 G + + H+ + AK S +G + R + + T V +Y A ++P + YCS +W Sbjct: 680 GVEIDEHLNWDQHIDSLAKKVSSGIGAMKRISEIANQNTLVSIYNAIIQPHLNYCSEVW 738 >SB_47464| Best HMM Match : RVT_1 (HMM E-Value=0.012) Length = 558 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/50 (34%), Positives = 28/50 (56%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 F +H+ K AS+ GVL R + ++ K+ L+K+ V P + YC +W Sbjct: 226 FSTHINEICKRASQRAGVLMRLRNLIPTNAKLQLFKSAVLPHLTYCHLVW 275 >SB_41708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 507 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/50 (34%), Positives = 28/50 (56%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 F +H+ K AS+ GVL R + ++ K+ L+K+ V P + YC +W Sbjct: 365 FSTHINEICKRASQRAGVLMRLRNLIPTNAKLQLFKSTVLPHLTYCHLVW 414 >SB_42669| Best HMM Match : Sorb (HMM E-Value=9.2) Length = 347 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/59 (27%), Positives = 28/59 (47%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 G + + H+ + AK S +G + R + T V +Y A ++P + YCS +W Sbjct: 152 GVEIDEHLNWDQHIDSLAKKVSSGIGAMKRISEFANQNTLVSIYNAIIQPHLNYCSEMW 210 >SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) Length = 361 Score = 37.9 bits (84), Expect = 0.008 Identities = 18/51 (35%), Positives = 29/51 (56%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++ H+K+ + ASK++G++ R H KV Y A VRP ++Y S W Sbjct: 172 KWSKHVKSTSGKASKVMGMIKRNFWNCHQRVKVTAYTAIVRPMLEYASAAW 222 Score = 33.1 bits (72), Expect = 0.23 Identities = 18/39 (46%), Positives = 22/39 (56%) Frame = -3 Query: 240 SFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRVLNRRQ 124 SF PRTIR WN LP+ + E + FKR L LN + Sbjct: 323 SFFPRTIRHWNTLPNELV-ELGSIEHFKRDLEIYLNNNK 360 >SB_35509| Best HMM Match : Sorb (HMM E-Value=9.2) Length = 256 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/59 (27%), Positives = 28/59 (47%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 G + + H+ + AK S +G + R + T V +Y A ++P + YCS +W Sbjct: 61 GVEIDEHLNWDQHIDSLAKKVSSGIGAMKRISEFANQNTLVSIYNAIIQPHLNYCSEVW 119 >SB_33398| Best HMM Match : Sorb (HMM E-Value=9.9) Length = 347 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/59 (27%), Positives = 28/59 (47%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 G + + H+ + AK S +G + R + T V +Y A ++P + YCS +W Sbjct: 152 GVEIDEHLNWDQHIDSLAKKVSSGIGAMKRISEFANQNTLVSIYNAIIQPHLNYCSEVW 210 >SB_33087| Best HMM Match : Fascin (HMM E-Value=8.9) Length = 347 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/59 (27%), Positives = 28/59 (47%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 G + + H+ + AK S +G + R + T V +Y A ++P + YCS +W Sbjct: 152 GVKIDEHLNWDQHIDSLAKKVSSGIGAMKRISEFANQNTLVSIYNAIIQPHLNYCSEVW 210 >SB_30852| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 623 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/59 (27%), Positives = 28/59 (47%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 G + + H+ + AK S +G + R + T V +Y A ++P + YCS +W Sbjct: 435 GVEIDEHLNWDQHIDSLAKKVSSGIGAMKRISEFANQNTLVSIYNAIIQPHLNYCSEVW 493 >SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) Length = 1683 Score = 37.5 bits (83), Expect = 0.011 Identities = 17/51 (33%), Positives = 27/51 (52%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++GSH A AS LG++ R + K YK VRP+++Y + +W Sbjct: 1146 RWGSHCSKIASSASSTLGIIRRTLKPCSREVKERAYKTLVRPKLEYAAAVW 1196 Score = 37.5 bits (83), Expect = 0.011 Identities = 17/51 (33%), Positives = 27/51 (52%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++GSH A AS LG++ R + K YK VRP+++Y + +W Sbjct: 1338 RWGSHCSKIASSASSTLGIIRRTLKPCSREVKERAYKTLVRPKLEYAAAVW 1388 >SB_22818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 37.5 bits (83), Expect = 0.011 Identities = 19/56 (33%), Positives = 28/56 (50%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWAGAPKT 506 +G+H+ K A +G + R K + + +YKA V+P YCS LW KT Sbjct: 101 WGNHIDKFCKKAGPGIGAIRRLKPFVPRESLETMYKALVQPYFDYCSPLWDTCGKT 156 >SB_22717| Best HMM Match : RuvA_C (HMM E-Value=7) Length = 256 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/59 (27%), Positives = 28/59 (47%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 G + + H+ + AK S +G + R + T V +Y A ++P + YCS +W Sbjct: 61 GVEIDEHLNWDQHIDSLAKKVSSGIGAMKRISEFANQNTLVSIYNAIIQPHLNYCSEVW 119 >SB_18662| Best HMM Match : Toxin_27 (HMM E-Value=2) Length = 253 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/50 (32%), Positives = 28/50 (56%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 F +H+ + AS+ GVL R + ++ K+ L+K+ V P + YC +W Sbjct: 104 FSTHINEICRRASQRAGVLMRLRNLIPTNAKLQLFKSAVLPHLTYCHLVW 153 >SB_57819| Best HMM Match : Sorb (HMM E-Value=9.2) Length = 207 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/59 (27%), Positives = 28/59 (47%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 G + + H+ + AK S +G + R + T V +Y A ++P + YCS +W Sbjct: 12 GVEIDEHLNWDQHIDSLAKKVSSGIGAMKRISEFANQNTLVSIYNAIIQPHLNYCSEVW 70 >SB_54752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 792 Score = 37.5 bits (83), Expect = 0.011 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRA-KRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 +G H++ A+++LG+L R +L T+ LLY VRP ++Y S +W+ Sbjct: 597 WGPHIEPMCAKANRVLGLLKRVCSDILDPTTRQLLYCTLVRPSLEYASCIWS 648 Score = 31.9 bits (69), Expect = 0.53 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = -3 Query: 249 FQRSFLPRTIRLWNELPS 196 ++ S+ PRT++LWN LPS Sbjct: 746 YRNSYFPRTVKLWNSLPS 763 >SB_51255| Best HMM Match : Sorb (HMM E-Value=9.2) Length = 211 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/59 (27%), Positives = 28/59 (47%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 G + + H+ + AK S +G + R + T V +Y A ++P + YCS +W Sbjct: 12 GVEIDEHLNWDQHIDSLAKKVSSGIGAMKRISEFANQNTLVSIYNAIIQPHLNYCSEVW 70 >SB_47529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/50 (32%), Positives = 28/50 (56%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 F +H+ + AS+ GVL R + ++ K+ L+K+ V P + YC +W Sbjct: 10 FSTHINEICRRASQRAGVLMRLRNLIPTNAKLQLFKSAVLPHLTYCHLVW 59 >SB_36813| Best HMM Match : RVT_1 (HMM E-Value=1.4e-14) Length = 382 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/59 (27%), Positives = 28/59 (47%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 G + + H+ + AK S +G + R + T V +Y A ++P + YCS +W Sbjct: 222 GVEIDEHLNWDQHIDSLAKKVSSGIGAMKRISEFANQNTLVSIYNAIIQPHLNYCSEVW 280 >SB_22738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 296 Score = 37.5 bits (83), Expect = 0.011 Identities = 19/56 (33%), Positives = 28/56 (50%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWAGAPKT 506 +G+H+ K A +G + R K + + +YKA V+P YCS LW KT Sbjct: 196 WGNHIDKFCKKAGPGIGAIRRLKPFVPRESLETMYKALVQPYFDYCSPLWDTCGKT 251 >SB_20783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 37.5 bits (83), Expect = 0.011 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRA-KRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 +G H++ A+++LG+L R +L T+ LLY VRP ++Y S +W+ Sbjct: 100 WGPHIEPMCAKANRVLGLLKRVCSDILDPTTRQLLYCTLVRPSLEYASCIWS 151 Score = 31.9 bits (69), Expect = 0.53 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = -3 Query: 249 FQRSFLPRTIRLWNELPS 196 ++ S+ PRT++LWN LPS Sbjct: 249 YRNSYFPRTVKLWNSLPS 266 >SB_14288| Best HMM Match : Sorb (HMM E-Value=9.9) Length = 347 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/59 (27%), Positives = 28/59 (47%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 G + + H+ + AK S +G + R + T V +Y A ++P + YCS +W Sbjct: 152 GVEIDEHLNWDQHIDSLAKKVSSGIGAMKRISEFANQNTLVSIYNAIIQPHLNYCSEVW 210 >SB_10251| Best HMM Match : RVT_1 (HMM E-Value=0.0022) Length = 717 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/59 (27%), Positives = 28/59 (47%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 G + + H+ + AK S +G + R + T V +Y A ++P + YCS +W Sbjct: 625 GVEIDEHLNWDQHIDSLAKKVSSGIGAMKRISEFANQNTLVSIYNAIIQPHLNYCSEVW 683 >SB_9596| Best HMM Match : BAF (HMM E-Value=1.54143e-44) Length = 759 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/59 (27%), Positives = 28/59 (47%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 G + + H+ + AK S +G + R + T V +Y A ++P + YCS +W Sbjct: 571 GVEIDEHLNWDQHIDSLAKKVSSGIGAMKRISEFANQNTLVSIYNAIIQPHLNYCSEVW 629 >SB_7670| Best HMM Match : Sorb (HMM E-Value=9.2) Length = 215 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/59 (27%), Positives = 28/59 (47%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 G + + H+ + AK S +G + R + T V +Y A ++P + YCS +W Sbjct: 61 GVEIDEHLNWDQHIDSLAKKVSSGIGAMKRISEFANQNTLVSIYNAIIQPHLNYCSEVW 119 >SB_3943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1457 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/59 (27%), Positives = 28/59 (47%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 G + + H+ + AK S +G + R + T V +Y A ++P + YCS +W Sbjct: 942 GVEIDEHLNWDQHIDSLAKKVSSGIGAMKRISEFANQNTLVSIYNAIIQPHLNYCSEVW 1000 >SB_63| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 680 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/59 (27%), Positives = 28/59 (47%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 G + + H+ + AK S +G + R + T V +Y A ++P + YCS +W Sbjct: 485 GVEIDEHLNWDQHIDSLAKKVSSGIGAMKRISEFANQNTLVSIYNAIIQPHLNYCSEVW 543 >SB_18451| Best HMM Match : Sorb (HMM E-Value=9.2) Length = 323 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = -2 Query: 664 HLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 H+ + AK S +G + R + T V +Y A ++P + YCS +W Sbjct: 140 HIDSLAKKVSSGIGAMKRISEFANQNTLVSIYNAIIQPHLNYCSEVW 186 >SB_43536| Best HMM Match : DUF1410 (HMM E-Value=3.5) Length = 344 Score = 37.1 bits (82), Expect = 0.014 Identities = 19/52 (36%), Positives = 29/52 (55%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWAG 518 F H+ K AS+ +GVL R + ++ K+ LYK+ + P + YC H AG Sbjct: 174 FSLHISEICKKASQKVGVLIRLRNLIPVDAKLQLYKSAILPNLTYC-HTVAG 224 >SB_56417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 36.7 bits (81), Expect = 0.019 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRA-KRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 +G H++ A+++LG++ R +L T+ LLY VRP ++Y S +W+ Sbjct: 52 WGPHIEPMCAKANRVLGLVKRVCSDILDPTTRQLLYCTLVRPHLEYASCIWS 103 Score = 33.1 bits (72), Expect = 0.23 Identities = 16/52 (30%), Positives = 30/52 (57%), Gaps = 1/52 (1%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRA-KRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 +G H++ A+++LG++ R +L T+ LL VRP ++Y S +W+ Sbjct: 230 WGPHIEPMCAKANRVLGLVKRVCSDILDPTTRQLLNCTLVRPHLEYASCIWS 281 >SB_34112| Best HMM Match : RVT_1 (HMM E-Value=0.041) Length = 858 Score = 36.7 bits (81), Expect = 0.019 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRA-KRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 +G H++ A+++LG++ R +L T+ LLY VRP ++Y S +W+ Sbjct: 694 WGPHIEPMCAKANRVLGLVKRVCSDILDPTTRQLLYCTLVRPHLEYASCIWS 745 >SB_42738| Best HMM Match : 7tm_1 (HMM E-Value=0.89) Length = 1354 Score = 36.7 bits (81), Expect = 0.019 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRA-KRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 +G H++ A+++LG++ R +L T+ LLY VRP ++Y S +W+ Sbjct: 845 WGPHIEPMCAKANRVLGLVKRVCSDILDPTTRQLLYCTLVRPHLEYASCIWS 896 >SB_30760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1868 Score = 36.7 bits (81), Expect = 0.019 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRA-KRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 +G H++ A+++LG++ R +L T+ LLY VRP ++Y S +W+ Sbjct: 1738 WGPHIEPMCAKANRVLGLVKRVCSDILDPTTRQLLYCTLVRPHLEYASCIWS 1789 >SB_16492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 36.7 bits (81), Expect = 0.019 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRA-KRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 +G H++ A+++LG++ R +L T+ LLY VRP ++Y S +W+ Sbjct: 100 WGPHIEPMCAKANRVLGLVKRVCSDILDPTTRQLLYCTLVRPHLEYASCIWS 151 Score = 31.9 bits (69), Expect = 0.53 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = -3 Query: 249 FQRSFLPRTIRLWNELPS 196 ++ S+ PRT++LWN LPS Sbjct: 249 YRNSYFPRTVKLWNSLPS 266 >SB_6581| Best HMM Match : HEAT (HMM E-Value=3e-05) Length = 1188 Score = 36.7 bits (81), Expect = 0.019 Identities = 16/59 (27%), Positives = 27/59 (45%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 G + + + H+ K+K S +G L R + + T +YKA + P YC +W Sbjct: 1013 GLHIDKNLSWEKHIDEKSKKLSSGIGALERVRPFVSRGTACTIYKALIEPHFDYCRPVW 1071 >SB_4883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 721 Score = 36.7 bits (81), Expect = 0.019 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRA-KRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 +G H++ A+++LG++ R +L T+ LLY VRP ++Y S +W+ Sbjct: 521 WGPHIEPMCAKANRVLGLVKRVCSDILDPTTRQLLYCTLVRPHLEYASCIWS 572 >SB_54561| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 36.3 bits (80), Expect = 0.025 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRA-KRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 +G H++ A+++LG++ R +L T+ LLY VRP ++Y S +W+ Sbjct: 105 WGPHIEPMCAKANRVLGLVKRVCSDILDPTTRQLLYCTFVRPHLEYASCIWS 156 >SB_9025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 278 Score = 36.3 bits (80), Expect = 0.025 Identities = 16/59 (27%), Positives = 27/59 (45%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 G + + H+ + AK S +G R + T V +Y A ++P + YCS +W Sbjct: 83 GVEIDEHLNWDQHIDSLAKKVSSGIGATKRISEFANQNTLVSIYNAIIQPHLNYCSEVW 141 >SB_12628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1163 Score = 36.3 bits (80), Expect = 0.025 Identities = 16/50 (32%), Positives = 28/50 (56%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 F +H+ + AS+ GVL R + ++ K+ L+K+ V P + YC +W Sbjct: 571 FCTHINEICRRASQRAGVLMRLRNLIPTNAKLQLFKSAVLPHLTYCHLVW 620 >SB_6740| Best HMM Match : RVT_1 (HMM E-Value=4.5e-22) Length = 884 Score = 36.3 bits (80), Expect = 0.025 Identities = 16/50 (32%), Positives = 28/50 (56%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 F +H+ + AS+ GVL R + ++ K+ L+K+ V P + YC +W Sbjct: 431 FCTHINEICRRASQRAGVLMRLRNLIPTNAKLQLFKSAVLPHLTYCHLVW 480 >SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1) Length = 2075 Score = 35.9 bits (79), Expect = 0.033 Identities = 19/52 (36%), Positives = 25/52 (48%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 ++G H ASK LG+L R R K Y A VRP ++Y S W+ Sbjct: 1496 RWGDHCTKITSKASKTLGLLRRTLRPCSKEVKERAYLALVRPSLEYASSAWS 1547 Score = 33.5 bits (73), Expect = 0.17 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = -3 Query: 255 MRFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGL 148 + F SF PRTIR WN LP+ V D+ FK L Sbjct: 1642 LAFNYSFFPRTIRTWNLLPAEVV-NAADLPSFKSAL 1676 >SB_14726| Best HMM Match : Ribosomal_L30 (HMM E-Value=6.6) Length = 231 Score = 35.5 bits (78), Expect = 0.043 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = -3 Query: 249 FQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGL 148 ++ SFLPR +RLWN LP +V R F GL Sbjct: 198 YKYSFLPRALRLWNNLPQSVIDMRGCPEAFHSGL 231 >SB_48112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 232 Score = 35.5 bits (78), Expect = 0.043 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = -3 Query: 249 FQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGL 148 ++ SFLPR +RLWN LP +V R F GL Sbjct: 199 YKYSFLPRALRLWNNLPQSVIDMRGCPEAFHAGL 232 >SB_10495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 258 Score = 35.5 bits (78), Expect = 0.043 Identities = 15/59 (25%), Positives = 27/59 (45%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 G + + H+ + A S +G + R + T V +Y A ++P + YCS +W Sbjct: 152 GVEIDEHLNWDQHIDSLANKVSSGIGAMKRISEFANQNTLVSIYNAIIQPHLNYCSEVW 210 >SB_57037| Best HMM Match : RVT_1 (HMM E-Value=3.4e-15) Length = 291 Score = 35.1 bits (77), Expect = 0.057 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++GSH A AS LG++ R + K Y VRP+++Y + +W Sbjct: 228 RWGSHCSKIASSASSTLGIIRRTLKPCSREVKERAYMTLVRPKLEYAAAVW 278 >SB_56220| Best HMM Match : RVT_1 (HMM E-Value=3.7e-16) Length = 453 Score = 35.1 bits (77), Expect = 0.057 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++GSH A AS LG++ R + K Y VRP+++Y + +W Sbjct: 259 RWGSHCSKIASSASSTLGIIRRTLKPCSREVKERAYMTLVRPKLEYAAAVW 309 >SB_40620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 35.1 bits (77), Expect = 0.057 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++GSH A AS LG++ R + K Y VRP+++Y + +W Sbjct: 130 RWGSHCSKIASSASSTLGIIRRTLKPCSREVKERAYMTLVRPKLEYAAAVW 180 >SB_34116| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 522 Score = 35.1 bits (77), Expect = 0.057 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++GSH A AS LG++ R + K Y VRP+++Y + +W Sbjct: 328 RWGSHCSKIASSASSTLGIIRRTLKPCSREVKERAYMTLVRPKLEYAAAVW 378 >SB_33284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 35.1 bits (77), Expect = 0.057 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++GSH A AS LG++ R + K Y VRP+++Y + +W Sbjct: 114 RWGSHCSKIASSASSTLGIIRRTLKPCSREVKERAYMTLVRPKLEYAAAVW 164 >SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40) Length = 892 Score = 35.1 bits (77), Expect = 0.057 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++GSH A AS LG++ R + K Y VRP+++Y + +W Sbjct: 698 RWGSHCSKIASSASSTLGIIRRTLKPCSREVKERAYMTLVRPKLEYAAAVW 748 >SB_26992| Best HMM Match : rve (HMM E-Value=6.3e-36) Length = 1022 Score = 35.1 bits (77), Expect = 0.057 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++GSH A AS LG++ R + K Y VRP+++Y + +W Sbjct: 887 RWGSHCSKIASSASSTLGIIRRTLKPCSREVKERAYMTLVRPKLEYAAAVW 937 >SB_22251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 497 Score = 35.1 bits (77), Expect = 0.057 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++GSH A AS LG++ R + K Y VRP+++Y + +W Sbjct: 303 RWGSHCSKIASSASSTLGIIRRTLKPCSREVKERAYMTLVRPKLEYAAAVW 353 >SB_51232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1676 Score = 35.1 bits (77), Expect = 0.057 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++GSH A AS LG++ R + K Y VRP+++Y + +W Sbjct: 950 RWGSHCSKIASSASSTLGIIRRTLKPCSREVKERAYMTLVRPKLEYAAAVW 1000 >SB_23276| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 35.1 bits (77), Expect = 0.057 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++GSH A AS LG++ R + K Y VRP+++Y + +W Sbjct: 130 RWGSHCSKIASSASSTLGIIRRTLKPCSREVKERAYMTLVRPKLEYAAAVW 180 >SB_11067| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1176 Score = 35.1 bits (77), Expect = 0.057 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++GSH A AS LG++ R + K Y VRP+++Y + +W Sbjct: 1034 RWGSHCSKIASSASSTLGIIRRTLKPCSREVKERAYMTLVRPKLEYAAAVW 1084 >SB_5024| Best HMM Match : rve (HMM E-Value=6.3e-36) Length = 1677 Score = 35.1 bits (77), Expect = 0.057 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++GSH A AS LG++ R + K Y VRP+++Y + +W Sbjct: 1436 RWGSHCSKIASSASSTLGIIRRTLKPCSREVKERAYMTLVRPKLEYAAAVW 1486 >SB_58751| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 34.7 bits (76), Expect = 0.075 Identities = 19/60 (31%), Positives = 28/60 (46%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 G + + H + K A+ +LG+L R A K YKA VRP V+Y + W+ Sbjct: 110 GVHISTSLNWSKHTEEVKKKANAVLGILQRNLSPCPAAVKEQAYKALVRPLVEYGTEAWS 169 >SB_57671| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 533 Score = 34.7 bits (76), Expect = 0.075 Identities = 19/60 (31%), Positives = 28/60 (46%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 G + + H + K A+ +LG+L R A K YKA VRP V+Y + W+ Sbjct: 393 GVHISTSLNWSKHTEEVKKKANAVLGILQRNLSSCPAAVKEQAYKALVRPLVEYGTEAWS 452 >SB_53749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 34.7 bits (76), Expect = 0.075 Identities = 19/60 (31%), Positives = 28/60 (46%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 G + + H + K A+ +LG+L R A K YKA VRP V+Y + W+ Sbjct: 31 GVHISTSLNWSKHTEEVKKKANAVLGILQRNLSSCPAAVKEQAYKALVRPLVEYGTEAWS 90 >SB_53367| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1025 Score = 34.7 bits (76), Expect = 0.075 Identities = 19/60 (31%), Positives = 28/60 (46%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 G + + H + K A+ +LG+L R A K YKA VRP V+Y + W+ Sbjct: 905 GVHISTSLNWSKHTEEVKKKANAVLGILQRNLSSCPAAVKEQAYKALVRPLVEYGTEAWS 964 >SB_12291| Best HMM Match : Exo_endo_phos (HMM E-Value=1.8e-09) Length = 843 Score = 34.7 bits (76), Expect = 0.075 Identities = 19/60 (31%), Positives = 28/60 (46%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 G + + H + K A+ +LG+L R A K YKA VRP V+Y + W+ Sbjct: 632 GVHISTSLNWSKHTEEVKKKANAVLGILQRNLSSCPAAVKEQAYKALVRPLVEYGTEAWS 691 >SB_49175| Best HMM Match : RVT_1 (HMM E-Value=1.8e-32) Length = 823 Score = 34.7 bits (76), Expect = 0.075 Identities = 19/60 (31%), Positives = 28/60 (46%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 G + + H + K A+ +LG+L R A K YKA VRP V+Y + W+ Sbjct: 385 GVHISTSLNWSKHTEEVKKKANAVLGILQRNLSSCPAAVKEQAYKALVRPLVEYGTEAWS 444 >SB_35779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 305 Score = 34.7 bits (76), Expect = 0.075 Identities = 19/60 (31%), Positives = 28/60 (46%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 G + + H + K A+ +LG+L R A K YKA VRP V+Y + W+ Sbjct: 211 GVHISTSLNWSKHTEEVKKKANAVLGILQRNLSSCPAAVKEQAYKALVRPLVEYGTEAWS 270 >SB_30161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 265 Score = 34.7 bits (76), Expect = 0.075 Identities = 19/60 (31%), Positives = 28/60 (46%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 G + + H + K A+ +LG+L R A K YKA VRP V+Y + W+ Sbjct: 125 GVHISTSLNWSKHTEEVKKKANAVLGILQRNLSSCPAAVKEQAYKALVRPLVEYGTEAWS 184 >SB_25515| Best HMM Match : Complex1_LYR (HMM E-Value=9.6) Length = 304 Score = 34.7 bits (76), Expect = 0.075 Identities = 19/60 (31%), Positives = 28/60 (46%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 G + + H + K A+ +LG+L R A K YKA VRP V+Y + W+ Sbjct: 106 GVHISTSLNWSKHTEEVKKKANAVLGILQRNLSSCPAAVKEQAYKALVRPLVEYGTEAWS 165 >SB_11838| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1009 Score = 34.7 bits (76), Expect = 0.075 Identities = 19/60 (31%), Positives = 28/60 (46%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 G + + H + K A+ +LG+L R A K YKA VRP V+Y + W+ Sbjct: 837 GVHISTSLNWSKHTEEVKKKANAVLGILQRNLSSCPAAVKEQAYKALVRPLVEYGTEAWS 896 >SB_11114| Best HMM Match : UPF0203 (HMM E-Value=9.6) Length = 197 Score = 34.7 bits (76), Expect = 0.075 Identities = 19/60 (31%), Positives = 28/60 (46%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 G + + H + K A+ +LG+L R A K YKA VRP V+Y + W+ Sbjct: 57 GVHISTSLNWSKHTEEVKKKANAVLGILQRNLSSCPAAVKEQAYKALVRPLVEYGTEAWS 116 >SB_17007| Best HMM Match : VWA (HMM E-Value=4.6e-06) Length = 453 Score = 34.3 bits (75), Expect = 0.100 Identities = 19/60 (31%), Positives = 28/60 (46%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 G + + H + K A+ +LG+L R A K YKA VRP V+Y + W+ Sbjct: 303 GVHISTSLNWSKHTEEVKKKANAVLGILQRNLSSCPAAVKEQAYKALVRPLVEYGTKAWS 362 >SB_58989| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 885 Score = 34.3 bits (75), Expect = 0.100 Identities = 14/51 (27%), Positives = 27/51 (52%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++ H+ +S+ LG L R ++ K Y+ VRP+++YC+ +W Sbjct: 170 KWNKHIDDITAKSSRTLGFLKRNLKINSPTLKAKAYQGLVRPKLEYCASVW 220 Score = 34.3 bits (75), Expect = 0.100 Identities = 14/51 (27%), Positives = 27/51 (52%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++ H+ +S+ LG L R ++ K Y+ VRP+++YC+ +W Sbjct: 693 KWNKHIDDITAKSSRTLGFLKRNLKINSPTLKAKAYQGLVRPKLEYCASVW 743 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -3 Query: 240 SFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRV 139 SF RTI WN LP+ +F E + FK + R+ Sbjct: 846 SFFSRTIIQWNNLPALLFNEPCSLPIFKDKISRL 879 >SB_29819| Best HMM Match : Ribosomal_L39 (HMM E-Value=4.1) Length = 300 Score = 34.3 bits (75), Expect = 0.100 Identities = 16/52 (30%), Positives = 30/52 (57%), Gaps = 1/52 (1%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRA-KRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 +G H++ A+++LG+ R +L ++ LLY VRP ++Y S +W+ Sbjct: 228 WGPHIEPMCAKANRVLGLAKRVCSDILDPTSRQLLYCTLVRPHLEYASCIWS 279 >SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1273 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/51 (33%), Positives = 28/51 (54%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++ H+K+ + ASK++G++ R KV Y A VRP ++Y S W Sbjct: 880 KWSKHVKSTSGKASKVMGMIKRNFWNCPQRVKVTAYTAIVRPMLEYASAAW 930 >SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) Length = 375 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/51 (33%), Positives = 28/51 (54%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++ H+K+ + ASK++G++ R KV Y A VRP ++Y S W Sbjct: 186 KWSKHVKSTSGKASKVMGMIKRNFWNCPQRVKVTAYTAIVRPMLEYASAAW 236 Score = 33.1 bits (72), Expect = 0.23 Identities = 18/39 (46%), Positives = 22/39 (56%) Frame = -3 Query: 240 SFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRVLNRRQ 124 SF PRTIR WN LP+ + E + FKR L LN + Sbjct: 337 SFFPRTIRHWNTLPNELV-ELGSIEHFKRDLEIYLNNNK 374 >SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) Length = 609 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/51 (33%), Positives = 28/51 (54%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++ H+K+ + ASK++G++ R KV Y A VRP ++Y S W Sbjct: 418 KWSKHVKSTSGKASKVMGMIKRNFWNCPQRVKVTAYTAIVRPMLEYASAAW 468 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 240 SFLPRTIRLWNELPS 196 SF PRTIR WN LP+ Sbjct: 569 SFFPRTIRHWNTLPN 583 >SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 864 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/51 (33%), Positives = 28/51 (54%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++ H+K+ + ASK++G++ R KV Y A VRP ++Y S W Sbjct: 602 KWSKHVKSTSGKASKVMGMIKRNFWNCPQRVKVTAYTAIVRPMLEYASAAW 652 >SB_462| Best HMM Match : RVT_1 (HMM E-Value=7.7e-25) Length = 863 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/51 (33%), Positives = 28/51 (54%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++ H+K+ + ASK++G++ R KV Y A VRP ++Y S W Sbjct: 704 KWSKHVKSTSGKASKVMGMIKRNFWNCPQRVKVTAYTAIVRPMLEYASAAW 754 >SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 581 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/51 (33%), Positives = 28/51 (54%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++ H+K+ + ASK++G++ R KV Y A VRP ++Y S W Sbjct: 392 KWSKHVKSTSGKASKVMGMIKRNFWNCPQRVKVTAYTAIVRPMLEYASAAW 442 Score = 33.1 bits (72), Expect = 0.23 Identities = 18/39 (46%), Positives = 22/39 (56%) Frame = -3 Query: 240 SFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRVLNRRQ 124 SF PRTIR WN LP+ + E + FKR L LN + Sbjct: 543 SFFPRTIRHWNTLPNELV-ELGSIEHFKRDLEIYLNNNK 580 >SB_40765| Best HMM Match : DX (HMM E-Value=1.4) Length = 278 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/51 (33%), Positives = 28/51 (54%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++ H+K+ + ASK++G++ R KV Y A VRP ++Y S W Sbjct: 89 KWSKHVKSTSGKASKVMGMIKRNFWNCPQRVKVTAYTAIVRPMLEYASAAW 139 Score = 33.1 bits (72), Expect = 0.23 Identities = 18/39 (46%), Positives = 22/39 (56%) Frame = -3 Query: 240 SFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRVLNRRQ 124 SF PRTIR WN LP+ + E + FKR L LN + Sbjct: 240 SFFPRTIRHWNTLPNELV-ELDSIEHFKRDLEIYLNNNK 277 >SB_38808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 824 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/51 (33%), Positives = 28/51 (54%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++ H+K+ + ASK++G++ R KV Y A VRP ++Y S W Sbjct: 635 KWSKHVKSTSGKASKVMGMIKRNFWNCPQRVKVTAYTAIVRPMLEYASAAW 685 Score = 33.1 bits (72), Expect = 0.23 Identities = 18/39 (46%), Positives = 22/39 (56%) Frame = -3 Query: 240 SFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRVLNRRQ 124 SF PRTIR WN LP+ + E + FKR L LN + Sbjct: 786 SFFPRTIRHWNTLPNELV-ELGSIEHFKRDLEIYLNNNK 823 >SB_29272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 719 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/51 (33%), Positives = 28/51 (54%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++ H+K+ + ASK++G++ R KV Y A VRP ++Y S W Sbjct: 594 KWSKHVKSTSGKASKVMGMIKRNFWNCPQRVKVTAYTAIVRPMLEYASAAW 644 >SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 666 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/51 (33%), Positives = 28/51 (54%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++ H+K+ + ASK++G++ R KV Y A VRP ++Y S W Sbjct: 477 KWSKHVKSTSGKASKVMGMIKRNFWNCPQRVKVTAYTAIVRPMLEYASAAW 527 Score = 33.1 bits (72), Expect = 0.23 Identities = 18/39 (46%), Positives = 22/39 (56%) Frame = -3 Query: 240 SFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRVLNRRQ 124 SF PRTIR WN LP+ + E + FKR L LN + Sbjct: 628 SFFPRTIRHWNTLPNELV-ELGSIEHFKRDLEIYLNNNK 665 >SB_18871| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 546 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/51 (33%), Positives = 28/51 (54%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++ H+K+ + ASK++G++ R KV Y A VRP ++Y S W Sbjct: 410 KWSKHVKSTSGKASKVMGMMKRNFWNCPQRVKVTAYTAIVRPMLEYASAAW 460 >SB_14841| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1821 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/59 (23%), Positives = 26/59 (44%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 G + + H+ + K S +G + R + V +Y A ++P + YCS +W Sbjct: 1626 GVEIDEHLNWDQHIDSLVKKVSSGIGAMKRISEFANQNALVSIYNAIIQPHLNYCSEVW 1684 >SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3142 Score = 33.5 bits (73), Expect = 0.17 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = -3 Query: 255 MRFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGL 148 + F SF PRTIR WN LP+ V D+ FK L Sbjct: 1088 LAFNYSFFPRTIRTWNLLPAEVV-NAADLPSFKSAL 1122 >SB_43828| Best HMM Match : XPG_N (HMM E-Value=1.8) Length = 174 Score = 33.1 bits (72), Expect = 0.23 Identities = 18/39 (46%), Positives = 22/39 (56%) Frame = -3 Query: 240 SFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRVLNRRQ 124 SF PRTIR WN LP+ + E + FKR L LN + Sbjct: 136 SFFPRTIRHWNTLPNELV-ELGSIEHFKRDLEIYLNNNK 173 >SB_10379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 265 Score = 33.1 bits (72), Expect = 0.23 Identities = 18/60 (30%), Positives = 27/60 (45%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 G + + H + K A+ +LG+L R K YKA VRP V+Y + W+ Sbjct: 125 GVHISTSLNWSKHTEEVKKKANAVLGILQRNLSSCPVAVKEQAYKALVRPLVEYGTEAWS 184 >SB_9857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1125 Score = 33.1 bits (72), Expect = 0.23 Identities = 17/64 (26%), Positives = 30/64 (46%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 G N + + SH+ AK S+ +G L + + + T + +YK+ + YC +W Sbjct: 68 GFNIDERLSWSSHIDNIAKRVSQAIGGLRQIRPYVPQNTLISIYKSLILQLFDYCDVIWG 127 Query: 520 GAPK 509 A K Sbjct: 128 TANK 131 >SB_51699| Best HMM Match : SAM_2 (HMM E-Value=1.5) Length = 442 Score = 32.7 bits (71), Expect = 0.30 Identities = 15/43 (34%), Positives = 25/43 (58%) Frame = -2 Query: 652 KAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 K+ AS+ GVL R + ++ K+ L+K+ V P + YC +W Sbjct: 2 KSVRASQRAGVLIRLRNLIPTNAKLQLFKSAVLPHLTYCHLVW 44 >SB_36728| Best HMM Match : ArsD (HMM E-Value=1.6) Length = 364 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = -2 Query: 640 ASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 AS +GVL ++++ K+ +YKA + P + YC W Sbjct: 301 ASLRIGVLMCLRKLIPVTAKLRIYKAAILPHLSYCGLTW 339 >SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 918 Score = 32.3 bits (70), Expect = 0.40 Identities = 18/35 (51%), Positives = 19/35 (54%) Frame = -3 Query: 240 SFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRVL 136 SF PRTIR WN LPS V E + FK VL Sbjct: 873 SFFPRTIRTWNLLPSEVI-ESSSIDSFKSSALPVL 906 >SB_47667| Best HMM Match : Ldl_recept_a (HMM E-Value=0) Length = 3891 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -1 Query: 233 CHVPSGYGMSSPPRCFPSAMTCPSSNEAC 147 C P GY + +P RC S +C SS AC Sbjct: 2147 CSCPQGYRLENPYRCVLSNASCASSEFAC 2175 >SB_31373| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) Length = 198 Score = 32.3 bits (70), Expect = 0.40 Identities = 18/35 (51%), Positives = 19/35 (54%) Frame = -3 Query: 240 SFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRVL 136 SF PRTIR WN LPS V E + FK VL Sbjct: 153 SFFPRTIRTWNLLPSEVI-ESSSIDSFKSSALPVL 186 >SB_30049| Best HMM Match : FBA_2 (HMM E-Value=7) Length = 282 Score = 32.3 bits (70), Expect = 0.40 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 ++G H A A+K LG + R + K Y + VRP ++Y S W+ Sbjct: 87 RWGPHCSKIATKANKTLGAIRRTLKPCEPAVKERAYLSLVRPSLEYASAAWS 138 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -3 Query: 255 MRFQRSFLPRTIRLWNELPSTV 190 + + SF R IR+WN LPS V Sbjct: 232 LSYNYSFFARAIRIWNLLPSNV 253 >SB_27524| Best HMM Match : RVT_1 (HMM E-Value=1.30321e-43) Length = 593 Score = 32.3 bits (70), Expect = 0.40 Identities = 16/62 (25%), Positives = 27/62 (43%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 G + ++ F H + K + +GVLN+ K L + Y A ++P Y +W Sbjct: 384 GLDVDSKLTFSDHAERTYKKIAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQ 443 Query: 520 GA 515 A Sbjct: 444 TA 445 >SB_24320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 32.3 bits (70), Expect = 0.40 Identities = 16/62 (25%), Positives = 27/62 (43%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 G + ++ F H + K + +GVLN+ K L + Y A ++P Y +W Sbjct: 57 GLDVDSKLTFSDHAERTYKKIAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQ 116 Query: 520 GA 515 A Sbjct: 117 TA 118 >SB_24260| Best HMM Match : Rotavirus_VP7 (HMM E-Value=7.7) Length = 319 Score = 32.3 bits (70), Expect = 0.40 Identities = 16/62 (25%), Positives = 27/62 (43%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 G + ++ F H + K + +GVLN+ K L + Y A ++P Y +W Sbjct: 160 GLDVDSKLTFSDHAERTYKKIAGRIGVLNKIKGCLPIKQRTNFYNAMIKPLFSYAGTVWQ 219 Query: 520 GA 515 A Sbjct: 220 TA 221 >SB_12986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 32.3 bits (70), Expect = 0.40 Identities = 16/62 (25%), Positives = 27/62 (43%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 G + ++ F H + K + +GVLN+ K L + Y A ++P Y +W Sbjct: 59 GLDVDSKLTFSDHAERTYKKIAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQ 118 Query: 520 GA 515 A Sbjct: 119 TA 120 >SB_7633| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 32.3 bits (70), Expect = 0.40 Identities = 16/62 (25%), Positives = 27/62 (43%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 G + ++ F H + K + +GVLN+ K L + Y A ++P Y +W Sbjct: 178 GLDVDSKLTFSDHAERTYKKIAGRIGVLNKIKGCLPIKQRTNFYNAMIKPLFSYAGTVWQ 237 Query: 520 GA 515 A Sbjct: 238 TA 239 >SB_7040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 32.3 bits (70), Expect = 0.40 Identities = 16/62 (25%), Positives = 27/62 (43%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 G + ++ F H + K + +GVLN+ K L + Y A ++P Y +W Sbjct: 119 GLDVDSKLTFSDHAERTYKKIAGRIGVLNKIKGCLPIKQRTNFYNAMIKPLFSYAGTVWQ 178 Query: 520 GA 515 A Sbjct: 179 TA 180 >SB_51096| Best HMM Match : Baculo_ME53 (HMM E-Value=5.6) Length = 238 Score = 32.3 bits (70), Expect = 0.40 Identities = 16/62 (25%), Positives = 27/62 (43%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 G + ++ F H + K + +GVLN+ K L + Y A ++P Y +W Sbjct: 119 GLDVDSKLTFSDHAERTYKKIAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQ 178 Query: 520 GA 515 A Sbjct: 179 TA 180 >SB_41403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1415 Score = 32.3 bits (70), Expect = 0.40 Identities = 16/62 (25%), Positives = 27/62 (43%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 G + ++ F H + K + +GVLN+ K L + Y A ++P Y +W Sbjct: 178 GLDVDSKLTFSDHAERTYKKIAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQ 237 Query: 520 GA 515 A Sbjct: 238 TA 239 >SB_18362| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 32.3 bits (70), Expect = 0.40 Identities = 16/62 (25%), Positives = 27/62 (43%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 G + ++ F H + K + +GVLN+ K L + Y A ++P Y +W Sbjct: 54 GLDVDSKLTFSDHAERTYKKIAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQ 113 Query: 520 GA 515 A Sbjct: 114 TA 115 >SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) Length = 837 Score = 32.3 bits (70), Expect = 0.40 Identities = 18/35 (51%), Positives = 19/35 (54%) Frame = -3 Query: 240 SFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRVL 136 SF PRTIR WN LPS V E + FK VL Sbjct: 792 SFFPRTIRTWNLLPSEVI-ESSSIDSFKSSALPVL 825 >SB_17278| Best HMM Match : RVT_1 (HMM E-Value=0.0082) Length = 506 Score = 32.3 bits (70), Expect = 0.40 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 ++G H A A+K LG + R + K Y + VRP ++Y S W+ Sbjct: 311 RWGPHCSKIATKANKTLGAIRRTLKPCEPAVKERAYLSLVRPSLEYASAAWS 362 Score = 31.5 bits (68), Expect = 0.70 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -3 Query: 255 MRFQRSFLPRTIRLWNELPSTV 190 + + SF PR IR+WN LPS V Sbjct: 456 LSYNYSFFPRAIRIWNLLPSNV 477 >SB_17216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 32.3 bits (70), Expect = 0.40 Identities = 16/62 (25%), Positives = 27/62 (43%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 G + ++ F H + K + +GVLN+ K L + Y A ++P Y +W Sbjct: 59 GLDVDSKLTFSDHAERTYKKIAGRIGVLNKIKGCLPIKQRTNFYNAMIKPLFSYAGTVWQ 118 Query: 520 GA 515 A Sbjct: 119 TA 120 >SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27) Length = 1492 Score = 32.3 bits (70), Expect = 0.40 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 ++G H A A+K LG + R + K Y + VRP ++Y S W+ Sbjct: 1297 RWGPHCSKIATKANKTLGAIRRTLKPCEPAVKERAYLSLVRPSLEYASAAWS 1348 Score = 31.5 bits (68), Expect = 0.70 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -3 Query: 255 MRFQRSFLPRTIRLWNELPSTV 190 + + SF PR IR+WN LPS V Sbjct: 1442 LSYNYSFFPRAIRIWNLLPSNV 1463 >SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39) Length = 452 Score = 32.3 bits (70), Expect = 0.40 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 ++G H A A+K LG + R + K Y + VRP ++Y S W+ Sbjct: 257 RWGPHCSKIATKANKTLGAIRRTLKPCEPAVKERAYLSLVRPSLEYASAAWS 308 Score = 31.5 bits (68), Expect = 0.70 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -3 Query: 255 MRFQRSFLPRTIRLWNELPSTV 190 + + SF PR IR+WN LPS V Sbjct: 402 LSYNYSFFPRAIRIWNLLPSNV 423 >SB_6674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 303 Score = 32.3 bits (70), Expect = 0.40 Identities = 16/62 (25%), Positives = 27/62 (43%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 G + ++ F H + K + +GVLN+ K L + Y A ++P Y +W Sbjct: 94 GLDVDSKLTFSDHAERTYKKIAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQ 153 Query: 520 GA 515 A Sbjct: 154 TA 155 >SB_2851| Best HMM Match : RVT_1 (HMM E-Value=3.50325e-43) Length = 890 Score = 32.3 bits (70), Expect = 0.40 Identities = 16/62 (25%), Positives = 27/62 (43%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 G + ++ F H + K + +GVLN+ K L + Y A ++P Y +W Sbjct: 681 GLDVDSKLTFSDHAERTYKKIAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQ 740 Query: 520 GA 515 A Sbjct: 741 TA 742 >SB_51388| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 670 Score = 31.9 bits (69), Expect = 0.53 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++ H+ A++ LGV+ R R K LY + VRP+++Y + +W Sbjct: 374 KWDKHIAQITSSANQTLGVIRRNFRTASVDCKSKLYCSLVRPKLEYANSVW 424 >SB_27537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 396 Score = 31.9 bits (69), Expect = 0.53 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++ H+ A++ LGV+ R R K LY + VRP+++Y + +W Sbjct: 205 KWDKHIAQITSSANQTLGVIRRNFRTASVDCKSKLYCSLVRPKLEYANSVW 255 >SB_17181| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 668 Score = 31.9 bits (69), Expect = 0.53 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++ H+ A++ LGV+ R R K LY + VRP+++Y + +W Sbjct: 477 KWDKHIAQITSSANQTLGVIRRNFRTASVDCKSKLYCSLVRPKLEYANSVW 527 >SB_4935| Best HMM Match : Pox_F16 (HMM E-Value=5.3) Length = 243 Score = 31.9 bits (69), Expect = 0.53 Identities = 18/35 (51%), Positives = 19/35 (54%) Frame = -3 Query: 240 SFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRVL 136 SF PRTIR WN LPS V E + FK VL Sbjct: 198 SFFPRTIRTWNLLPSEVV-ESSSIDSFKSSALPVL 231 >SB_51961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 31.9 bits (69), Expect = 0.53 Identities = 17/56 (30%), Positives = 26/56 (46%) Frame = -3 Query: 255 MRFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRVLNRRQRLGSAPGIAEVH 88 + + SF PR IR+WN LPS V + + FK + + + L + G H Sbjct: 137 LSYNYSFFPRAIRIWNLLPSNVI-NQVTLEAFKSAALPAIRQLKCLRTYAGFKADH 191 >SB_51257| Best HMM Match : Pox_F16 (HMM E-Value=4.1) Length = 243 Score = 31.9 bits (69), Expect = 0.53 Identities = 18/35 (51%), Positives = 19/35 (54%) Frame = -3 Query: 240 SFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRVL 136 SF PRTIR WN LPS V E + FK VL Sbjct: 198 SFFPRTIRTWNLLPSEVV-ESSSIDSFKSSALPVL 231 >SB_43623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 475 Score = 31.9 bits (69), Expect = 0.53 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = -2 Query: 667 SHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 S++K ++ +G + R K + T + +Y A ++P YCS +W Sbjct: 193 SNIKQVSRKVFCGIGAIRRVKDYVDRNTLISIYNALIKPHFGYCSEVW 240 >SB_33578| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00076) Length = 888 Score = 31.9 bits (69), Expect = 0.53 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = -3 Query: 249 FQRSFLPRTIRLWNELPSTVFPERY 175 F+ SF+PR IRLWN L TV Y Sbjct: 744 FKYSFVPRAIRLWNSLEVTVVLAAY 768 >SB_33076| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) Length = 152 Score = 31.9 bits (69), Expect = 0.53 Identities = 18/35 (51%), Positives = 19/35 (54%) Frame = -3 Query: 240 SFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRVL 136 SF PRTIR WN LPS V E + FK VL Sbjct: 107 SFFPRTIRTWNLLPSEVV-ESSSIDSFKSSALPVL 140 >SB_10962| Best HMM Match : PHD (HMM E-Value=5.3e-05) Length = 521 Score = 31.9 bits (69), Expect = 0.53 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++ H+ A++ LGV+ R R K LY + VRP+++Y + +W Sbjct: 330 KWDKHIAQITSSANQTLGVIRRNFRTASVDCKSKLYCSLVRPKLEYANSVW 380 >SB_8501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 543 Score = 31.5 bits (68), Expect = 0.70 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +2 Query: 458 RQSERPSSVWSQMEEAGFGSPGPKMGAVLHARPDLCFIKQNLCPG 592 R+ E P+ WS E SP P H+ PD+ ++ LC G Sbjct: 223 RKKEDPNMEWSSDSELSVASPAPSPSQ--HSVPDIVSLQGRLCEG 265 >SB_51996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 31.5 bits (68), Expect = 0.70 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWAGA 515 F H + K + +GVLN+ K L + Y A ++P Y +W A Sbjct: 176 FSDHAERTYKKIAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQTA 228 >SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 788 Score = 31.5 bits (68), Expect = 0.70 Identities = 16/28 (57%), Positives = 17/28 (60%) Frame = -3 Query: 240 SFLPRTIRLWNELPSTVFPERYDMSFFK 157 SF PRTIR WN LPS V E + FK Sbjct: 564 SFFPRTIRTWNLLPSEVI-ESSSIDSFK 590 >SB_4548| Best HMM Match : WD40 (HMM E-Value=6.7e-35) Length = 844 Score = 31.5 bits (68), Expect = 0.70 Identities = 14/59 (23%), Positives = 26/59 (44%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 G E + H + ++ K LG+L R K L + + + ++P + YC +W Sbjct: 644 GVQMENTLSWKKHSEYVSQKIRKRLGLLRRTKHFLSMTARKMFFNVLIQPLMDYCITVW 702 >SB_59792| Best HMM Match : RVT_1 (HMM E-Value=4.2039e-45) Length = 565 Score = 31.1 bits (67), Expect = 0.93 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++ H+ A++ LGV+ R R K LY + VRP+++Y + W Sbjct: 374 KWDKHIAQITSSANQTLGVIRRNFRTASVDCKSKLYCSLVRPKLEYANSAW 424 >SB_51588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 31.1 bits (67), Expect = 0.93 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++ H+ A++ LGV+ R R K LY + VRP+++Y + W Sbjct: 40 KWDKHIAQITSSANQTLGVIRRNFRTASVDCKSKLYCSLVRPKLEYANSAW 90 >SB_42960| Best HMM Match : RVT_1 (HMM E-Value=2.38221e-44) Length = 455 Score = 31.1 bits (67), Expect = 0.93 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++ H+ A++ LGV+ R R K LY + VRP+++Y + W Sbjct: 264 KWDKHIAQITSSANQTLGVIRRNFRTASVDCKSKLYCSLVRPKLEYANSAW 314 >SB_40301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2653 Score = 31.1 bits (67), Expect = 0.93 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = +3 Query: 360 RALPMEHTVQNTEGTEVPPQTQRLQTIRENG-IIDNPNGPPLYGVKWKKLVLG 515 +A P+ + + T PP+ R T R G ++ +P + GV+W+KLV G Sbjct: 2253 KAFPVTVLQNSVKVTNEPPKGLRANTKRAFGELMADPFESHVLGVRWRKLVFG 2305 >SB_24880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 243 Score = 31.1 bits (67), Expect = 0.93 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++ H+ A++ LGV+ R R K LY + VRP+++Y + W Sbjct: 87 KWDKHIAQITSSANQTLGVIRRNFRTASVDCKSKLYCSLVRPKLEYANSAW 137 >SB_7292| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1126 Score = 31.1 bits (67), Expect = 0.93 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++ H+ A++ LGV+ R R K LY + VRP+++Y + W Sbjct: 935 KWDKHIAQITSSANQTLGVIRRNFRTASVDCKSKLYCSLVRPKLEYANSAW 985 >SB_2407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 31.1 bits (67), Expect = 0.93 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++ H+ A++ LGV+ R R K LY + VRP+++Y + W Sbjct: 43 KWDKHIAQITSSANQTLGVIRRNFRTASVDCKSKLYCSLVRPKLEYANSAW 93 >SB_49613| Best HMM Match : Transposase_5 (HMM E-Value=0.033) Length = 999 Score = 31.1 bits (67), Expect = 0.93 Identities = 14/47 (29%), Positives = 23/47 (48%) Frame = -2 Query: 664 HLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 H+ A+ S +G L R + T + ++ A +RP YCS +W Sbjct: 173 HIDNVAEKVSSGIGALRRILDFVDRDTLLSIHNAIIRPHFNYCSEVW 219 >SB_45340| Best HMM Match : RVT_1 (HMM E-Value=1.2e-15) Length = 447 Score = 31.1 bits (67), Expect = 0.93 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++ H+ A++ LGV+ R R K LY + VRP+++Y + W Sbjct: 256 KWDKHIAQITSSANQTLGVIRRNFRTASVDCKSKLYCSLVRPKLEYANSAW 306 >SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23) Length = 2386 Score = 31.1 bits (67), Expect = 0.93 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = -3 Query: 240 SFLPRTIRLWNELPSTV 190 SF PRTIR WN LPS V Sbjct: 460 SFFPRTIRTWNLLPSEV 476 >SB_39321| Best HMM Match : RVT_1 (HMM E-Value=4.5e-39) Length = 900 Score = 31.1 bits (67), Expect = 0.93 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++ H+ A++ LGV+ R R K LY + VRP+++Y + W Sbjct: 709 KWDKHIAQITSSANQTLGVIRRNFRTASVDCKSKLYCSLVRPKLEYANSAW 759 >SB_38334| Best HMM Match : RVT_1 (HMM E-Value=5.60519e-45) Length = 435 Score = 31.1 bits (67), Expect = 0.93 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++ H+ A++ LGV+ R R K LY + VRP+++Y + W Sbjct: 374 KWDKHIAQITSSANQTLGVIRRNFRTASVDCKSKLYCSLVRPKLEYANSAW 424 >SB_33045| Best HMM Match : RVT_1 (HMM E-Value=3.4e-18) Length = 1061 Score = 31.1 bits (67), Expect = 0.93 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++ H+ A++ LGV+ R R K LY + VRP+++Y + W Sbjct: 870 KWDKHIAQITSSANQTLGVIRRNFRTASVDCKSKLYCSLVRPKLEYANSAW 920 >SB_41746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = -2 Query: 649 AKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 AK A++ LG++ R + A K+ +A VRP ++Y S W Sbjct: 29 AKKANRTLGIVRRMLKPCDATVKLKADEALVRPPLEYASAAW 70 >SB_37654| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 865 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -3 Query: 249 FQRSFLPRTIRLWNELPSTVFP 184 F SF RTI +WN LP VFP Sbjct: 826 FLFSFYSRTIPVWNALPQAVFP 847 >SB_31120| Best HMM Match : Pox_F16 (HMM E-Value=5) Length = 284 Score = 30.7 bits (66), Expect = 1.2 Identities = 17/35 (48%), Positives = 19/35 (54%) Frame = -3 Query: 240 SFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRVL 136 SF PRTIR WN LP+ V E + FK VL Sbjct: 239 SFFPRTIRTWNLLPAQVV-ESSSIDSFKSSALPVL 272 >SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 662 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 + H++ A++ LG + R R K YK VRP+++Y S +W+ Sbjct: 482 WSKHIQNITGKANRSLGFIKRNLRKCPESVKTQGYKTLVRPQLEYASTVWS 532 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/21 (57%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -3 Query: 249 FQRSFLPRTIRLWNELP-STV 190 F+ SF P IR+WN LP ST+ Sbjct: 630 FKESFFPHAIRMWNGLPVSTI 650 >SB_19530| Best HMM Match : EMI (HMM E-Value=3.5) Length = 244 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 + H++ A++ LG + R R K YK VRP+++Y S +W+ Sbjct: 64 WSKHIQNITGKANRSLGFIKRNLRKCPESVKTQGYKTLVRPQLEYASTVWS 114 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/21 (57%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -3 Query: 249 FQRSFLPRTIRLWNELP-STV 190 F+ SF P IR+WN LP ST+ Sbjct: 212 FKESFFPHAIRMWNGLPVSTI 232 >SB_51544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++ H+ A++ LGV+ R R K LY + VRP+++Y + W Sbjct: 40 KWDKHIAQITSSANQTLGVIRRNFRTASVDCKSKLYCSLVRPKLEYANTAW 90 >SB_22968| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1332 Score = 30.7 bits (66), Expect = 1.2 Identities = 18/65 (27%), Positives = 29/65 (44%) Frame = -2 Query: 706 NWGSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHL 527 N G + F HLK K AS L + + ++ L + +L A + ++ YC+ L Sbjct: 878 NLGVILDKYLSFEDHLKTVCKSASFHLRNIGKIRKYLEKNSTEILIHAFISSKLDYCNSL 937 Query: 526 WAGAP 512 G P Sbjct: 938 LYGLP 942 >SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28) Length = 570 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++G H ++ A+K+LG+L R + K Y VRP ++Y + W Sbjct: 376 RWGPHASKISEKANKVLGLLRRTLKPCSQLVKERAYFTLVRPILEYAAPAW 426 Score = 27.9 bits (59), Expect = 8.6 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -3 Query: 255 MRFQRSFLPRTIRLWNELPSTV 190 + F SF R IR+WN LP+ V Sbjct: 520 LAFNYSFFARAIRIWNLLPNDV 541 >SB_14835| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) Length = 382 Score = 30.3 bits (65), Expect = 1.6 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 5/59 (8%) Frame = -2 Query: 640 ASKMLGVLNRAKRV-LHAWTKVLLYKAQVRPRVKYCSHLWA----GAPKTSFFHLTPYR 479 AS G L R KR + TK+ +Y+A V P + Y S W A K + FH T R Sbjct: 164 ASAAFGRLQRLKRRGIRTDTKIKVYRAVVLPTLLYGSETWTIYKRHAMKLNHFHTTCLR 222 >SB_24457| Best HMM Match : TPR_2 (HMM E-Value=1.4e-16) Length = 1134 Score = 29.9 bits (64), Expect = 2.1 Identities = 17/61 (27%), Positives = 25/61 (40%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWAGAPKTSFFH 494 +G H KA + LG + R + K Y + VRP ++Y S W+ T Sbjct: 1041 WGPHCAKKATKGYRTLGAIRRTLKHCAPEVKERAYLSLVRPMLEYASTSWSPYTDTDVLR 1100 Query: 493 L 491 L Sbjct: 1101 L 1101 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++G H + A+K+LG+L R + K Y VRP ++Y + W Sbjct: 86 RWGPHASKISDKANKVLGLLRRTLKPCSQLVKERAYFTLVRPILEYAAPAW 136 >SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 402 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++G H + A+K+LG+L R + K Y VRP ++Y + W Sbjct: 326 RWGPHASKISDKANKVLGLLRRTLKPCSQLVKERAYFTLVRPILEYAAPAW 376 >SB_28404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 292 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++G H + A+K+LG+L R + K Y VRP ++Y + W Sbjct: 214 RWGPHASKISDKANKVLGLLRRTLKPCSQLVKERAYFTLVRPILEYAAPAW 264 >SB_26110| Best HMM Match : HipA_C (HMM E-Value=5.5) Length = 210 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++G H + A+K+LG+L R + K Y VRP ++Y + W Sbjct: 16 RWGPHASKISDKANKVLGLLRRTLKPCSQLVKERAYFTLVRPILEYAAPAW 66 Score = 27.9 bits (59), Expect = 8.6 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -3 Query: 255 MRFQRSFLPRTIRLWNELPSTV 190 + F SF R IR+WN LP+ V Sbjct: 160 LAFNYSFFARAIRIWNLLPNDV 181 >SB_25497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++G H + A+K+LG+L R + K Y VRP ++Y + W Sbjct: 170 RWGPHASKISDKANKVLGLLRRTLKPCSQLVKERAYFTLVRPILEYAAPAW 220 Score = 27.9 bits (59), Expect = 8.6 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -3 Query: 255 MRFQRSFLPRTIRLWNELPSTV 190 + F SF R IR+WN LP+ V Sbjct: 314 LAFNYSFFARAIRIWNLLPNDV 335 >SB_24153| Best HMM Match : I_LWEQ (HMM E-Value=0.44) Length = 563 Score = 29.9 bits (64), Expect = 2.1 Identities = 17/60 (28%), Positives = 27/60 (45%) Frame = +2 Query: 227 RGKKDLWKRMWMTAVAPGSMDELYSGGGRCDGKNEMPVSSRTIPQSTPHGTYGTKYRGNR 406 RG + +KR +T+ A G G + + + ++ I ST HG + RGNR Sbjct: 338 RGNRQKYKRKTVTSTAHGKTASTARGNRQKYKRKTVTSTAHGITASTAHGKPASTARGNR 397 >SB_14729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++G H + A+K+LG+L R + K Y VRP ++Y + W Sbjct: 121 RWGPHASKISDKANKVLGLLRRTLKPCSQLVKERAYFTLVRPILEYAAPAW 171 Score = 27.9 bits (59), Expect = 8.6 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -3 Query: 255 MRFQRSFLPRTIRLWNELPSTV 190 + F SF R IR+WN LP+ V Sbjct: 265 LAFNYSFFARAIRIWNLLPNDV 286 >SB_10258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++G H + A+K+LG+L R + K Y VRP ++Y + W Sbjct: 90 RWGPHASKISDKANKVLGLLRRTLKPCSQLVKERAYFTLVRPILEYAAPAW 140 >SB_2458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = -2 Query: 676 QFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 ++G H + A+K+LG+L R + K Y VRP ++Y + W Sbjct: 360 RWGPHASKISDKANKVLGLLRRTLKPCSQLVKERAYFTLVRPILEYAAPAW 410 >SB_56295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 246 Score = 29.5 bits (63), Expect = 2.8 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 2/69 (2%) Frame = -2 Query: 709 ENWGSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRV-LHAWTKVLLYKAQVRPRVKYCS 533 +N G + +H+ K A+K L L KR L++ V +Y +RP ++YCS Sbjct: 87 KNLGMTLSDDLTWNNHVTECIKKANKRLFFLVLLKRAGLNSSDIVNIYCTMIRPVLEYCS 146 Query: 532 HLWAGA-PK 509 +++ A PK Sbjct: 147 NVYHNALPK 155 >SB_30264| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 689 Score = 29.5 bits (63), Expect = 2.8 Identities = 14/51 (27%), Positives = 26/51 (50%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 + H++ A++ LG + + R K YK VRP+++Y S +W+ Sbjct: 550 WSKHIQNITGKANRSLGFIKKNLRKCPESVKTQGYKTLVRPQLEYASTVWS 600 >SB_25119| Best HMM Match : Ribosomal_S27 (HMM E-Value=9.4) Length = 443 Score = 29.5 bits (63), Expect = 2.8 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -3 Query: 255 MRFQRSFLPRTIRLWNELPSTV 190 + F SF PR IR WN LP + Sbjct: 277 LSFNYSFFPRAIRAWNLLPDNI 298 >SB_36259| Best HMM Match : PHD (HMM E-Value=5.3e-05) Length = 790 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -3 Query: 240 SFLPRTIRLWNELPSTVFPE-RYDMSFFKRGLWRVLNRR 127 SF P +I+ WN LP+T R + SF +R+ R+ Sbjct: 752 SFFPWSIKFWNNLPATALKSTRVNQSFLIPSDFRINKRK 790 >SB_43036| Best HMM Match : Chorion_3 (HMM E-Value=1.6) Length = 621 Score = 29.1 bits (62), Expect = 3.7 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = -3 Query: 153 GLWRVLNRRQRLGSAPGIAEVHGRRVPHSPSGGPYASSALQG 28 G+ RV +RRQ + SAP A+VH +PS +A+ ++ G Sbjct: 557 GIDRVPSRRQSMDSAP--AKVHAEGAAPAPSPRTHAAHSMSG 596 >SB_23862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3112 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 4/41 (9%) Frame = -1 Query: 263 SSTCVSRGLFC-HVPSGYGM---SSPPRCFPSAMTCPSSNE 153 + TC++ G C P+G +SPP C P++ C + E Sbjct: 799 TDTCIANGSSCSQCPAGQSFCEKTSPPSCIPASQYCLAPRE 839 >SB_9412| Best HMM Match : Peptidase_M1 (HMM E-Value=3.1e-07) Length = 1844 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 41 DEAYGPPDGEWGTRRPWTSAMPGAEPSRC 127 D + PDG G +PW + PG++P C Sbjct: 443 DNSCNKPDGSTGDYQPWVN--PGSKPRNC 469 >SB_2368| Best HMM Match : Patched (HMM E-Value=8.6e-08) Length = 1420 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +2 Query: 272 APGSMDELYSGGGRCDGKNEMPVSSRTIPQSTPHGTYGTKY 394 AP S+++ GGG C G+N +PV+ P G GT Y Sbjct: 770 APTSLEDFKWGGGPCLGENGVPVN----PNIALGGFEGTDY 806 >SB_59170| Best HMM Match : RVT_1 (HMM E-Value=0.13) Length = 679 Score = 28.3 bits (60), Expect = 6.5 Identities = 15/56 (26%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRAKRV-LHAWTKVLLYKAQVRPRVKYCSHLWAGAPK 509 + +H A K A+K L + K+ L + + +Y + +RP ++Y S +W+ P+ Sbjct: 523 WNTHCDAIVKKATKRLYAIRALKKSGLSSNNLIQVYCSTMRPVLEYASPVWSALPE 578 >SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2346 Score = 28.3 bits (60), Expect = 6.5 Identities = 16/65 (24%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRV-LHAWTKVLLYKAQVRPRVKYCSHLW 524 G + + + +H A K A+K L + K+ L + + +Y + +RP ++Y S +W Sbjct: 996 GVHITSDLSWNTHCDAIVKKATKRLYAIRALKKSGLSSNDLIQVYCSTMRPVLEYASPVW 1055 Query: 523 AGAPK 509 + P+ Sbjct: 1056 SALPE 1060 >SB_42059| Best HMM Match : RVT_1 (HMM E-Value=0.0011) Length = 272 Score = 28.3 bits (60), Expect = 6.5 Identities = 16/65 (24%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRV-LHAWTKVLLYKAQVRPRVKYCSHLW 524 G + + + +H A K A+K L + K+ L + + +Y + +RP ++Y S +W Sbjct: 206 GVHITSDLSWNTHCDAIVKKATKRLYAIRALKKSGLSSNDLIQVYCSTMRPVLEYASPVW 265 Query: 523 AGAPK 509 + P+ Sbjct: 266 SALPE 270 >SB_35764| Best HMM Match : RVT_1 (HMM E-Value=8.1e-13) Length = 362 Score = 28.3 bits (60), Expect = 6.5 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRAKRVLHAW-TKVLLYKAQVRPRVKYCSHLWA 521 + H+ A+K+LG L R T+ LY A VRP + Y + +W+ Sbjct: 302 WSKHVTESCAKANKLLGFLRRTTVDFGCIRTRRTLYLAVVRPALGYATQVWS 353 >SB_35675| Best HMM Match : TB (HMM E-Value=8.4) Length = 251 Score = 28.3 bits (60), Expect = 6.5 Identities = 12/47 (25%), Positives = 25/47 (53%) Frame = -2 Query: 664 HLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLW 524 H+ + SK +G++ +A L + + LY + + P ++YC +W Sbjct: 80 HISNVTRKVSKAVGIMYKASFCLPKRSLMTLYYSLIFPYLQYCICVW 126 >SB_28392| Best HMM Match : Exo_endo_phos (HMM E-Value=0.77) Length = 549 Score = 28.3 bits (60), Expect = 6.5 Identities = 17/64 (26%), Positives = 31/64 (48%), Gaps = 1/64 (1%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRV-LHAWTKVLLYKAQVRPRVKYCSHLW 524 G + + + H++ K ASK L L K+ + + V +Y +R ++Y + +W Sbjct: 387 GVHLSSDLMWNMHVEYVIKKASKRLYALRSLKKSGVQSNDLVCIYCVLIRAVLEYAAPVW 446 Query: 523 AGAP 512 AG P Sbjct: 447 AGLP 450 >SB_26687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 614 Score = 28.3 bits (60), Expect = 6.5 Identities = 17/65 (26%), Positives = 28/65 (43%) Frame = -2 Query: 706 NWGSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHL 527 N G + F HLK K A L + + ++ L + +L A + ++ YC+ L Sbjct: 464 NLGVILDKCLSFEDHLKTVCKSARFHLRNIGKIRKYLDKNSTEILIHAFISSKLDYCNSL 523 Query: 526 WAGAP 512 G P Sbjct: 524 LYGLP 528 >SB_21705| Best HMM Match : Sorb (HMM E-Value=9.2) Length = 169 Score = 28.3 bits (60), Expect = 6.5 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -2 Query: 586 TKVLLYKAQVRPRVKYCSHLW 524 T V +Y A ++P + YCS +W Sbjct: 12 TLVSIYNAIIQPHLNYCSEMW 32 >SB_18309| Best HMM Match : Exo_endo_phos (HMM E-Value=2.3e-09) Length = 895 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = -2 Query: 628 LGVLNRAKRVLHAWTKVLLYKAQVRPRVKYCSHLWA 521 L N ++ HA K YKA VRP V+Y + W+ Sbjct: 747 LSANNIITQLQHAAVKEQAYKALVRPLVEYGTEAWS 782 >SB_38708| Best HMM Match : p450 (HMM E-Value=1.4) Length = 176 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/43 (32%), Positives = 24/43 (55%) Frame = +3 Query: 66 VSGVPVAHGLQQCQGQSQAAAFCLILSTSLV*RRTCHSARETP 194 +S +P + G + C GQS A A ++ ++ R T + R+TP Sbjct: 107 LSFLPFSLGRRVCVGQSVAKAELFLIVARMIQRYTFETPRDTP 149 >SB_33858| Best HMM Match : RVT_1 (HMM E-Value=3.7e-21) Length = 692 Score = 28.3 bits (60), Expect = 6.5 Identities = 15/56 (26%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRAKRV-LHAWTKVLLYKAQVRPRVKYCSHLWAGAPK 509 + +H A K A+K L + K+ L + + +Y + +RP ++Y S +W+ P+ Sbjct: 536 WNTHCDAIVKKATKRLYAIRALKKCGLSSNDLIQVYCSTMRPVLEYASPVWSALPE 591 >SB_27893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 28.3 bits (60), Expect = 6.5 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRAKRVLHAW-TKVLLYKAQVRPRVKYCSHLWA 521 + H+ A+K+LG L R T+ LY A VRP + Y + +W+ Sbjct: 141 WSKHVTESCAKANKLLGFLRRTTVDFGCIRTRRTLYLAVVRPALGYATQVWS 192 >SB_25427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1198 Score = 28.3 bits (60), Expect = 6.5 Identities = 25/71 (35%), Positives = 34/71 (47%), Gaps = 3/71 (4%) Frame = +2 Query: 236 KDLWKRMWMTAVAPGSMDELYSGGGRCDGKNEMPVSSRTI--PQSTP-HGTYGTKYRGNR 406 +DL + A +P S D YS G G E P+S RTI P+++P T G Y + Sbjct: 210 RDLHRPYSERATSPIS-DRGYSTPGYSVGSYERPLSPRTISEPRASPISPTLGDSYMSSY 268 Query: 407 SPSADPEAPND 439 S D + ND Sbjct: 269 SSPVDSDV-ND 278 >SB_22824| Best HMM Match : Herpes_gI (HMM E-Value=1.8) Length = 1255 Score = 28.3 bits (60), Expect = 6.5 Identities = 16/33 (48%), Positives = 21/33 (63%) Frame = -3 Query: 159 KRGLWRVLNRRQRLGSAPGIAEVHGRRVPHSPS 61 + G+ RV +RRQ GSAP A+VH V +PS Sbjct: 528 QHGIDRVPSRRQSKGSAP--AKVHAEGVAPAPS 558 >SB_15890| Best HMM Match : ArsC (HMM E-Value=0.94) Length = 310 Score = 28.3 bits (60), Expect = 6.5 Identities = 15/56 (26%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRAKRV-LHAWTKVLLYKAQVRPRVKYCSHLWAGAPK 509 + +H A K A+K L + K+ L + + +Y + +RP ++Y S +W+ P+ Sbjct: 154 WNTHCDAIVKKATKRLYAIRALKKSGLSSNNLIQVYCSTMRPVLEYASPVWSALPE 209 >SB_38681| Best HMM Match : RVT_1 (HMM E-Value=0.0082) Length = 559 Score = 27.9 bits (59), Expect = 8.6 Identities = 15/56 (26%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRAKRV-LHAWTKVLLYKAQVRPRVKYCSHLWAGAPK 509 + +H A K A+K L + K+ L + + +Y + +RP ++Y S +W+ P+ Sbjct: 403 WNTHCDAIVKKATKRLYAIRALKKSGLSSNDLIQVYCSTMRPVLEYASPVWSALPE 458 >SB_33307| Best HMM Match : NAF1 (HMM E-Value=1.5e-18) Length = 1085 Score = 27.9 bits (59), Expect = 8.6 Identities = 19/55 (34%), Positives = 23/55 (41%) Frame = -1 Query: 323 YHRTARHRSRVHPYYLGPLRSSTCVSRGLFCHVPSGYGMSSPPRCFPSAMTCPSS 159 YHR H P+ + P R VS PSG+ + PPR FP P S Sbjct: 992 YHRAPGHPFDQGPFLMEPGRFPPPVS------YPSGHRVPPPPRPFPMGAGQPPS 1040 >SB_23460| Best HMM Match : 7tm_1 (HMM E-Value=0.44) Length = 267 Score = 27.9 bits (59), Expect = 8.6 Identities = 12/48 (25%), Positives = 23/48 (47%) Frame = +1 Query: 397 REPKSLRRPRGSKRSVRMGLSTIRTALLCMESNGRSWFWEPRPKDGSS 540 ++P + RR + R V++ ++ + LCM N W W G++ Sbjct: 52 KKPLAKRRSHRNMRIVKIFIALVVAFALCMAPNHIMWIWHDYGDGGAN 99 >SB_22775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 249 FQRSFLPRTIRLWN 208 F SF+PRTIR WN Sbjct: 111 FDMSFIPRTIRTWN 124 >SB_20797| Best HMM Match : SoxE (HMM E-Value=0.046) Length = 641 Score = 27.9 bits (59), Expect = 8.6 Identities = 17/55 (30%), Positives = 27/55 (49%) Frame = +1 Query: 340 IISNNSSEHSPWNIRYKIQREPKSLRRPRGSKRSVRMGLSTIRTALLCMESNGRS 504 ++ N + ++ K ++ PK+ RP S S + LST+RT SNG S Sbjct: 383 VVVNREYQQRMQVVKRKRKKRPKTTIRPEDSTPSTQATLSTLRT---LTTSNGSS 434 >SB_18090| Best HMM Match : RVT_1 (HMM E-Value=0.59) Length = 427 Score = 27.9 bits (59), Expect = 8.6 Identities = 15/56 (26%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRAKRV-LHAWTKVLLYKAQVRPRVKYCSHLWAGAPK 509 + +H A K A+K L + K+ L + + +Y + +RP ++Y S +W+ P+ Sbjct: 271 WNTHCDAIVKKATKRLYAIRALKKSGLSSNDLIQVYCSTMRPVLEYASPVWSALPE 326 >SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30) Length = 1280 Score = 27.9 bits (59), Expect = 8.6 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -3 Query: 255 MRFQRSFLPRTIRLWNELPSTV 190 + F SF R IR+WN LP+ V Sbjct: 1230 LTFNYSFFARAIRIWNLLPNDV 1251 >SB_51268| Best HMM Match : SAP (HMM E-Value=2.3) Length = 204 Score = 27.9 bits (59), Expect = 8.6 Identities = 17/65 (26%), Positives = 31/65 (47%), Gaps = 1/65 (1%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRV-LHAWTKVLLYKAQVRPRVKYCSHLW 524 G + A + H+ K ASK L L ++ + VL+Y + +R ++Y + +W Sbjct: 87 GVHISADLSWNVHVDHLVKKASKRLYALRVLRKAGVQQSDMVLIYCSLIRSVLEYAAPVW 146 Query: 523 AGAPK 509 A P+ Sbjct: 147 ASLPE 151 >SB_32257| Best HMM Match : Sorb (HMM E-Value=5.7) Length = 169 Score = 27.9 bits (59), Expect = 8.6 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -2 Query: 586 TKVLLYKAQVRPRVKYCSHLW 524 T V +Y A ++P + YCS +W Sbjct: 12 TLVSIYNAIIQPHLNYCSEVW 32 >SB_26251| Best HMM Match : RVT_1 (HMM E-Value=0.0014) Length = 391 Score = 27.9 bits (59), Expect = 8.6 Identities = 17/65 (26%), Positives = 31/65 (47%), Gaps = 1/65 (1%) Frame = -2 Query: 700 GSNFEAIAQFGSHLKAKAKWASKMLGVLNRAKRV-LHAWTKVLLYKAQVRPRVKYCSHLW 524 G + A + H+ K ASK L L ++ + VL+Y + +R ++Y + +W Sbjct: 273 GVHISADLSWNVHVDHIVKKASKRLYALRVLRKAGIQQSDMVLIYCSLIRSVLEYAAPVW 332 Query: 523 AGAPK 509 A P+ Sbjct: 333 ASLPE 337 >SB_10275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 947 Score = 27.9 bits (59), Expect = 8.6 Identities = 15/56 (26%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = -2 Query: 673 FGSHLKAKAKWASKMLGVLNRAKRV-LHAWTKVLLYKAQVRPRVKYCSHLWAGAPK 509 + +H A K A+K L + K+ L + + +Y + +RP ++Y S +W+ P+ Sbjct: 572 WNTHCDAIVKKATKRLYAIRALKKSGLSSNDLIQVYCSTMRPVLEYASPVWSALPE 627 >SB_222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2323 Score = 27.9 bits (59), Expect = 8.6 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +3 Query: 246 GNACG*PQWPQVVWMNSTPVAGGAMVKTRCRYHLEQFLRA 365 G + G + QVVW S + G RC YH+ ++ +A Sbjct: 683 GFSSGTGHFTQVVWKGSVELGFGGGRAGRCTYHVGRYKKA 722 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,810,134 Number of Sequences: 59808 Number of extensions: 702131 Number of successful extensions: 2456 Number of sequences better than 10.0: 195 Number of HSP's better than 10.0 without gapping: 2162 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2449 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1889780269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -