BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0206 (678 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC110.04c |pss1|ssp1, SPAP14E8.01c|heat shock protein Pss1|Sch... 26 4.4 SPBC15C4.05 |||ATP-dependent RNA/DNA helicase |Schizosaccharomyc... 25 7.6 >SPAC110.04c |pss1|ssp1, SPAP14E8.01c|heat shock protein Pss1|Schizosaccharomyces pombe|chr 1|||Manual Length = 720 Score = 26.2 bits (55), Expect = 4.4 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +2 Query: 473 ISQVSSY*YKEDGDNIKVMLAVAIEDLLLEGGP 571 +++ + Y+E D K + +EDL+ GGP Sbjct: 614 LTKAEDWLYEEGEDTTKAVYTAKLEDLMRVGGP 646 >SPBC15C4.05 |||ATP-dependent RNA/DNA helicase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1428 Score = 25.4 bits (53), Expect = 7.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +3 Query: 303 FYSSCIFIIMSKRYSIHRFYLNTKIKFYYDD 395 F S + I K Y +HRFYL + + +D Sbjct: 802 FEGSNLITIPGKTYPVHRFYLEDILSQFGND 832 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,374,642 Number of Sequences: 5004 Number of extensions: 41396 Number of successful extensions: 89 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 88 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 311890690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -