BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0206 (678 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 58 7e-09 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 52 3e-07 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 52 4e-07 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 52 4e-07 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 51 7e-07 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 51 7e-07 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 51 1e-06 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 50 1e-06 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 50 1e-06 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 50 1e-06 SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 50 2e-06 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 50 2e-06 SB_39508| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 50 2e-06 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 50 2e-06 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 50 2e-06 SB_29177| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 49 3e-06 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_1945| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_969| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_357| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 49 4e-06 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 49 4e-06 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_9479| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_13215| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_51749| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_51748| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 48 5e-06 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 48 5e-06 SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 48 5e-06 SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) 48 5e-06 SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) 48 5e-06 SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 48 5e-06 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_20097| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_19885| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_16672| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2) 48 5e-06 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 48 7e-06 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 48 7e-06 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 48 7e-06 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) 48 7e-06 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 48 7e-06 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 48 7e-06 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 48 7e-06 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) 48 7e-06 SB_1099| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 48 9e-06 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 48 9e-06 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 48 9e-06 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 48 9e-06 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 48 9e-06 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 48 9e-06 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 48 9e-06 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 48 9e-06 SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) 48 9e-06 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 48 9e-06 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 48 9e-06 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) 48 9e-06 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 48 9e-06 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) 48 9e-06 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 48 9e-06 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 48 9e-06 SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) 48 9e-06 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 48 9e-06 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 48 9e-06 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_29477| Best HMM Match : Antistasin (HMM E-Value=9.2) 48 9e-06 SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) 48 9e-06 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 48 9e-06 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 48 9e-06 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_24322| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) 48 9e-06 SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 48 9e-06 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 48 9e-06 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 48 9e-06 SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 48 9e-06 SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) 48 9e-06 SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 48 9e-06 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) 48 9e-06 SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 48 9e-06 SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 48 9e-06 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 48 9e-06 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 48 9e-06 SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 48 9e-06 SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 48 9e-06 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 48 9e-06 SB_55182| Best HMM Match : T4_deiodinase (HMM E-Value=0) 48 9e-06 SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 48 9e-06 SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) 48 9e-06 SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 48 9e-06 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 48 9e-06 SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 48 9e-06 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 48 9e-06 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 48 9e-06 SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 48 9e-06 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 48 9e-06 SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 48 9e-06 SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) 48 9e-06 SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 48 9e-06 SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 48 9e-06 SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 48 9e-06 SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_35131| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_34873| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_34216| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 48 9e-06 SB_33422| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_33231| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_32024| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_31980| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_31481| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_31350| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_30835| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 48 9e-06 SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) 48 9e-06 SB_30218| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_29409| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_28808| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_28480| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_26038| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_25820| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_25742| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 48 9e-06 SB_25630| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_24684| Best HMM Match : Phage_rep_O (HMM E-Value=2.3) 48 9e-06 SB_24127| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 48 9e-06 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 48 9e-06 SB_23282| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_22993| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_21177| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 48 9e-06 SB_20277| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 48 9e-06 SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_17265| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_16846| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_16494| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_16270| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_16198| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_15539| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_14857| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_14581| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_14087| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_12828| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_12518| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 48 9e-06 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_11228| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_11209| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_11018| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_10523| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_10150| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 48 9e-06 SB_9090| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_8817| Best HMM Match : I-set (HMM E-Value=0) 48 9e-06 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_7590| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 48 9e-06 SB_7267| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_6665| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_6263| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 48 9e-06 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 48 9e-06 SB_4702| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_4674| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 48 9e-06 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_4402| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_4342| Best HMM Match : KA1 (HMM E-Value=0.53) 48 9e-06 SB_2432| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_2348| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_2263| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_1977| Best HMM Match : Filament_head (HMM E-Value=4.2) 48 9e-06 SB_1808| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_1435| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_1403| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_938| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_758| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 47 1e-05 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 47 1e-05 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 47 1e-05 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 47 1e-05 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 47 1e-05 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 47 1e-05 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 47 1e-05 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_39942| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 47 1e-05 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 47 1e-05 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 47 1e-05 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 47 1e-05 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_34403| Best HMM Match : IgG_binding_B (HMM E-Value=9.3) 47 1e-05 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 47 1e-05 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 47 1e-05 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 47 1e-05 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 47 1e-05 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 47 1e-05 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 47 1e-05 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 47 1e-05 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 47 1e-05 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 47 1e-05 SB_22375| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +1 Query: 580 IRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 IRPIVSRITIHWP +RRDWENPGV QLNRLA Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENPGVNQLNRLA 50 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 63.7 bits (148), Expect = 1e-10 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 592 VSRITIHWPVVLQRRDWENPGVTQLNRLA 678 +SRITIHWP VLQRRDWENPGVTQLNRLA Sbjct: 277 LSRITIHWPSVLQRRDWENPGVTQLNRLA 305 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 58.0 bits (134), Expect = 7e-09 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -1 Query: 678 CKAIKLGNARVFPVTTL*NDGPVNCNTTHYRANW 577 CKAIKLGNA VFP + PVNCNTTHYRANW Sbjct: 20 CKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 58.0 bits (134), Expect = 7e-09 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -1 Query: 678 CKAIKLGNARVFPVTTL*NDGPVNCNTTHYRANW 577 CKAIKLGNA VFP + PVNCNTTHYRANW Sbjct: 34 CKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 67 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 56.4 bits (130), Expect = 2e-08 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = -1 Query: 678 CKAIKLGNARVFPVTTL*NDGPVNCNTTHYRANW 577 CKAIKLGNA+ FP + PVNCNTTHYRANW Sbjct: 26 CKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 52.8 bits (121), Expect = 2e-07 Identities = 26/55 (47%), Positives = 31/55 (56%) Frame = +1 Query: 514 QHKGDASCCYRRLTARGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 +H+ Y RL G P+ ++ VVLQRRDWENPGVTQLNRLA Sbjct: 16 RHECSQDAMYGRLRQSGVGGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLA 70 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 52.4 bits (120), Expect = 3e-07 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = -1 Query: 678 CKAIKLGNARVFPVTTL*NDGPVNCNTTHYRANW 577 CK+IKL +A VFP + PVNCNTTHYRANW Sbjct: 28 CKSIKLAHASVFPSHDVVKRRPVNCNTTHYRANW 61 >SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) Length = 110 Score = 52.0 bits (119), Expect = 4e-07 Identities = 26/47 (55%), Positives = 31/47 (65%) Frame = +1 Query: 538 CYRRLTARGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 C R+L+ RG P+ ++ VVLQRRDWENPGVTQLNRLA Sbjct: 33 CKRKLSNRGD---PLESTCRHASLALAVVLQRRDWENPGVTQLNRLA 76 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 52.0 bits (119), Expect = 4e-07 Identities = 24/41 (58%), Positives = 28/41 (68%) Frame = +1 Query: 556 ARGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 A+GG P+ ++ VVLQRRDWENPGVTQLNRLA Sbjct: 50 AQGGVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLA 90 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 51.6 bits (118), Expect = 6e-07 Identities = 24/40 (60%), Positives = 27/40 (67%) Frame = +1 Query: 559 RGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 RGG P+ ++ VVLQRRDWENPGVTQLNRLA Sbjct: 43 RGGIGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLA 82 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 51.2 bits (117), Expect = 7e-07 Identities = 25/45 (55%), Positives = 31/45 (68%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPRAVSLR 543 ARRLSWVTPGFSQSRRCKTT +L ++ R P+ ++LR Sbjct: 49 ARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPKRMTLR 90 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 51.2 bits (117), Expect = 7e-07 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = -1 Query: 678 CKAIKLGNARVFPVTTL*NDGPVNCNTTHYRAN 580 CKAIKLGNAR FP PVNCNTTHYRAN Sbjct: 65 CKAIKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 50.8 bits (116), Expect = 1e-06 Identities = 26/53 (49%), Positives = 30/53 (56%) Frame = +1 Query: 520 KGDASCCYRRLTARGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 K S Y + G +YP ++ VVLQRRDWENPGVTQLNRLA Sbjct: 3 KASLSFIYGPRSYLGYIKYPPESTCRHASLALAVVLQRRDWENPGVTQLNRLA 55 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 50.4 bits (115), Expect = 1e-06 Identities = 27/49 (55%), Positives = 28/49 (57%) Frame = +1 Query: 532 SCCYRRLTARGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 S C R GGA PIRPIVSRITIHWP + TQLNRLA Sbjct: 26 SSCSRAAATDGGA--PIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLA 72 >SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) Length = 292 Score = 50.4 bits (115), Expect = 1e-06 Identities = 25/42 (59%), Positives = 29/42 (69%) Frame = +1 Query: 553 TARGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 TA+GG P+ ++ VVLQRRDWENPGVTQLNRLA Sbjct: 35 TAKGGD--PLESTCRHASLALAVVLQRRDWENPGVTQLNRLA 74 >SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) Length = 199 Score = 50.4 bits (115), Expect = 1e-06 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPRAVSLR*QQLASP 522 ARRLSWVTPGFSQSRRCKTT +L ++ R P + LR + +P Sbjct: 49 ARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPLTLLLRLDYIPAP 97 >SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 573 Score = 50.4 bits (115), Expect = 1e-06 Identities = 24/43 (55%), Positives = 30/43 (69%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPRAVS 549 ARRLSWVTPGFSQSRRCKTT +L ++ R P+++S Sbjct: 337 ARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPKSIS 376 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 50.0 bits (114), Expect = 2e-06 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = +1 Query: 538 CYRRLTARGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 C RR+ G P+ ++ VVLQRRDWENPGVTQLNRLA Sbjct: 630 CRRRVECEGD---PLESTCRHASLALAVVLQRRDWENPGVTQLNRLA 673 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 50.0 bits (114), Expect = 2e-06 Identities = 25/41 (60%), Positives = 28/41 (68%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPRA 555 ARRLSWVTPGFSQSRRCKTT +L ++ R PRA Sbjct: 49 ARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPRA 86 >SB_39508| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 1814 Score = 50.0 bits (114), Expect = 2e-06 Identities = 25/44 (56%), Positives = 29/44 (65%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPRAVSL 546 ARRLSWVTPGFSQSRRCKTT +L ++ R PR V + Sbjct: 719 ARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPRNVDI 759 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 50.0 bits (114), Expect = 2e-06 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = -1 Query: 678 CKAIKLGNARVFPVTTL*NDGPVNCNTTHYRAN 580 CKAIKLGNA VF + PVNCNTTHYRAN Sbjct: 8 CKAIKLGNASVFRSHDVVKRRPVNCNTTHYRAN 40 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/39 (61%), Positives = 26/39 (66%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPP 561 ARRLSWVTPGFSQSRRCKTT + L + G PP Sbjct: 49 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPFPP 87 >SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) Length = 283 Score = 49.6 bits (113), Expect = 2e-06 Identities = 25/44 (56%), Positives = 28/44 (63%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPRAVSL 546 ARRLSWVTPGFSQSRRCKTT + L + G P R + L Sbjct: 125 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPGPKRNLLL 168 >SB_29177| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/42 (57%), Positives = 28/42 (66%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPRAV 552 ARRLSWVTPGFSQSRRCKTT +L ++ R PR + Sbjct: 27 ARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPRTI 65 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 49.2 bits (112), Expect = 3e-06 Identities = 25/44 (56%), Positives = 29/44 (65%) Frame = +1 Query: 547 RLTARGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 +LT R G P+ ++ VVLQRRDWENPGVTQLNRLA Sbjct: 45 KLTVREGD--PLESTCRHASLALAVVLQRRDWENPGVTQLNRLA 86 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 49.2 bits (112), Expect = 3e-06 Identities = 24/40 (60%), Positives = 26/40 (65%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPR 558 ARRLSWVTPGFSQSRRCKTT + L + G P R Sbjct: 49 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPCPQR 88 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 49.2 bits (112), Expect = 3e-06 Identities = 24/44 (54%), Positives = 29/44 (65%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPRAVSL 546 ARRLSWVTPGFSQSRRCKTT +L ++ R PR+ + Sbjct: 49 ARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPRSTHI 89 >SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 49.2 bits (112), Expect = 3e-06 Identities = 24/46 (52%), Positives = 27/46 (58%) Frame = +1 Query: 541 YRRLTARGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 Y T R P+ ++ VVLQRRDWENPGVTQLNRLA Sbjct: 15 YTYQTTRSTVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLA 60 >SB_1945| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 49.2 bits (112), Expect = 3e-06 Identities = 24/43 (55%), Positives = 29/43 (67%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPRAVS 549 ARRLSWVTPGFSQSRRCKTT +L ++ R PR ++ Sbjct: 258 ARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPRCLA 297 >SB_969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 49.2 bits (112), Expect = 3e-06 Identities = 26/50 (52%), Positives = 30/50 (60%), Gaps = 1/50 (2%) Frame = +1 Query: 532 SCCYRRLTARGGARY-PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 +C Y L R A P+ ++ VVLQRRDWENPGVTQLNRLA Sbjct: 3 TCYYGHLLLRALASGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLA 52 >SB_357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 49.2 bits (112), Expect = 3e-06 Identities = 24/41 (58%), Positives = 28/41 (68%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPRA 555 ARRLSWVTPGFSQSRRCKTT ++L ++ R P A Sbjct: 27 ARRLSWVTPGFSQSRRCKTTAS---VKLACVQVDSRGCPEA 64 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 48.8 bits (111), Expect = 4e-06 Identities = 25/49 (51%), Positives = 30/49 (61%) Frame = +1 Query: 532 SCCYRRLTARGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 +C + AR G P+ ++ VVLQRRDWENPGVTQLNRLA Sbjct: 75 NCQTSKSNARAGD--PLESTCRHASLALAVVLQRRDWENPGVTQLNRLA 121 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/43 (55%), Positives = 29/43 (67%) Frame = +1 Query: 550 LTARGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 ++ RGG P+ ++ VVLQRRDWENPGVTQLNRLA Sbjct: 81 ISIRGGD--PLESTCRHASLALAVVLQRRDWENPGVTQLNRLA 121 >SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 48.8 bits (111), Expect = 4e-06 Identities = 25/43 (58%), Positives = 28/43 (65%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPRAVS 549 ARRLSWVTPGFSQSRRCKTT +L ++ R P VS Sbjct: 27 ARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPPVVS 66 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 48.8 bits (111), Expect = 4e-06 Identities = 23/45 (51%), Positives = 29/45 (64%) Frame = +1 Query: 544 RRLTARGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 ++L + G P+ ++ VVLQRRDWENPGVTQLNRLA Sbjct: 37 QQLRSLNGEGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLA 81 >SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 48.8 bits (111), Expect = 4e-06 Identities = 25/44 (56%), Positives = 29/44 (65%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPRAVSL 546 ARRLSWVTPGFSQSRRCKTT +L ++ R P+ V L Sbjct: 27 ARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPKYVLL 67 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 48.8 bits (111), Expect = 4e-06 Identities = 25/43 (58%), Positives = 28/43 (65%), Gaps = 1/43 (2%) Frame = +1 Query: 553 TAR-GGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 TAR G P+ ++ VVLQRRDWENPGVTQLNRLA Sbjct: 83 TARPAGVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLA 125 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 23/39 (58%), Positives = 26/39 (66%) Frame = +1 Query: 562 GGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 G A P+ ++ VVLQRRDWENPGVTQLNRLA Sbjct: 38 GDAGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLA 76 >SB_9479| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 48.8 bits (111), Expect = 4e-06 Identities = 23/43 (53%), Positives = 27/43 (62%) Frame = +1 Query: 550 LTARGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 LT G P+ ++ VVLQRRDW+NPGVTQLNRLA Sbjct: 2 LTDAGAIGNPLESTCRHASLALAVVLQRRDWQNPGVTQLNRLA 44 >SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 48.8 bits (111), Expect = 4e-06 Identities = 30/54 (55%), Positives = 33/54 (61%) Frame = +1 Query: 517 HKGDASCCYRRLTARGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 HK ASC TA+ + +SRIT VVLQRRDWEN GVTQLNRLA Sbjct: 68 HKLSASCFSHESTAQFCSAD-----LSRITNSLAVVLQRRDWENTGVTQLNRLA 116 >SB_13215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 48.8 bits (111), Expect = 4e-06 Identities = 25/43 (58%), Positives = 29/43 (67%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPRAVS 549 ARRLSWVTPGFSQSRRCKTT +L ++ R P+A S Sbjct: 27 ARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPQANS 66 >SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 48.8 bits (111), Expect = 4e-06 Identities = 23/41 (56%), Positives = 27/41 (65%) Frame = +1 Query: 556 ARGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 A+G P+ ++ VVLQRRDWENPGVTQLNRLA Sbjct: 17 AKGTKGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLA 57 >SB_51749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 48.4 bits (110), Expect = 5e-06 Identities = 24/40 (60%), Positives = 27/40 (67%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPR 558 ARRLSWVTPGFSQSR CKTT +L G++ YR R Sbjct: 71 ARRLSWVTPGFSQSRGCKTTTS---AKLACGQVDYRGSLR 107 >SB_51748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 48.4 bits (110), Expect = 5e-06 Identities = 24/40 (60%), Positives = 27/40 (67%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPR 558 ARRLSWVTPGFSQSR CKTT +L G++ YR R Sbjct: 71 ARRLSWVTPGFSQSRGCKTTTS---AKLACGQVDYRGSLR 107 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 48.4 bits (110), Expect = 5e-06 Identities = 24/47 (51%), Positives = 29/47 (61%) Frame = +1 Query: 538 CYRRLTARGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 C ++ RG P+ ++ VVLQRRDWENPGVTQLNRLA Sbjct: 19 CMQQAAIRGD---PLESTCRHASLALAVVLQRRDWENPGVTQLNRLA 62 >SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) Length = 631 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIG 585 ARRLSWVTPGFSQSRRCKTT + L +G Sbjct: 476 ARRLSWVTPGFSQSRRCKTTASAKLACLQVG 506 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 48.4 bits (110), Expect = 5e-06 Identities = 23/44 (52%), Positives = 27/44 (61%) Frame = +1 Query: 547 RLTARGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 R+ R P+ ++ VVLQRRDWENPGVTQLNRLA Sbjct: 51 RVETREACGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLA 94 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 48.4 bits (110), Expect = 5e-06 Identities = 32/74 (43%), Positives = 41/74 (55%), Gaps = 2/74 (2%) Frame = +1 Query: 463 RLHDFTSIFLLI*RR--WRQHKGDASCCYRRLTARGGARYPIRPIVSRITIHWPVVLQRR 636 R T+ LI R+ +R++K A CC +R P+ ++ VVLQRR Sbjct: 5 RFKSVTANLTLIGRKTVFRRYKF-AFCCQKRYGD------PLESTCRHASLALAVVLQRR 57 Query: 637 DWENPGVTQLNRLA 678 DWENPGVTQLNRLA Sbjct: 58 DWENPGVTQLNRLA 71 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 48.4 bits (110), Expect = 5e-06 Identities = 24/41 (58%), Positives = 28/41 (68%) Frame = +1 Query: 556 ARGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 A+GG P+ ++ VVLQRRDWENPGVTQLNRLA Sbjct: 85 AKGGD--PLESTCRHASLALAVVLQRRDWENPGVTQLNRLA 123 >SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 48.4 bits (110), Expect = 5e-06 Identities = 25/49 (51%), Positives = 30/49 (61%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPRAVSLR*QQL 531 ARRLSWVTPGFSQSRRCKTT + L + G + SL +Q+ Sbjct: 27 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPQGDKVCSLNLEQV 75 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 48.4 bits (110), Expect = 5e-06 Identities = 24/40 (60%), Positives = 27/40 (67%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPR 558 ARRLSWVTPGFSQSRRCKTT +L ++ R PR Sbjct: 49 ARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPR 85 >SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) Length = 128 Score = 48.4 bits (110), Expect = 5e-06 Identities = 24/40 (60%), Positives = 26/40 (65%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPR 558 ARRLSWVTPGFSQSRRCKTT + L + G PR Sbjct: 27 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPQGPR 66 >SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 48.4 bits (110), Expect = 5e-06 Identities = 24/39 (61%), Positives = 26/39 (66%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPP 561 ARRLSWVTPGFSQSRRCKTT + L + G A P Sbjct: 20 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPAVP 58 >SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) Length = 152 Score = 48.4 bits (110), Expect = 5e-06 Identities = 26/42 (61%), Positives = 28/42 (66%), Gaps = 4/42 (9%) Frame = +1 Query: 565 GARYPIRPIVSRITIHW----PVVLQRRDWENPGVTQLNRLA 678 G YP P SR + + VVLQRRDWENPGVTQLNRLA Sbjct: 42 GLNYPFVPKSSRHSESYYNSLAVVLQRRDWENPGVTQLNRLA 83 >SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 48.4 bits (110), Expect = 5e-06 Identities = 24/40 (60%), Positives = 26/40 (65%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPR 558 ARRLSWVTPGFSQSRRCKTT + L + G P R Sbjct: 27 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPPPVR 66 >SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) Length = 206 Score = 48.4 bits (110), Expect = 5e-06 Identities = 24/40 (60%), Positives = 27/40 (67%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPR 558 ARRLSWVTPGFSQSRRCKTT +L ++ R PR Sbjct: 49 ARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPR 85 >SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 48.4 bits (110), Expect = 5e-06 Identities = 27/58 (46%), Positives = 35/58 (60%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPRAVSLR*QQLASPLCCLHL 504 ARRLSWVTPGFSQSRRCKTT + L + G + +S+ + LAS L++ Sbjct: 49 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPILLKKISVFFRMLASTSLKLYI 106 >SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 48.4 bits (110), Expect = 5e-06 Identities = 24/40 (60%), Positives = 27/40 (67%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPR 558 ARRLSWVTPGFSQSRRCKTT +L ++ R PR Sbjct: 190 ARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPR 226 Score = 46.4 bits (105), Expect = 2e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +1 Query: 619 VVLQRRDWENPGVTQLNRLA 678 VVLQRRDWENPGVTQLNRLA Sbjct: 51 VVLQRRDWENPGVTQLNRLA 70 >SB_20097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 48.4 bits (110), Expect = 5e-06 Identities = 24/40 (60%), Positives = 27/40 (67%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPR 558 ARRLSWVTPGFSQSRRCKTT +L ++ R PR Sbjct: 8 ARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPR 44 >SB_19885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 48.4 bits (110), Expect = 5e-06 Identities = 25/44 (56%), Positives = 29/44 (65%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPRAVSL 546 ARRLSWVTPGFSQSRRCKTT +L ++ R P A +L Sbjct: 27 ARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPPAETL 67 >SB_16672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 48.4 bits (110), Expect = 5e-06 Identities = 27/53 (50%), Positives = 32/53 (60%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPRAVSLR*QQLASPL 519 ARRLSWVTPGFSQSRRCKTT +L ++ R P + R Q+ S L Sbjct: 27 ARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPGYDTRRQTQILSTL 76 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 48.4 bits (110), Expect = 5e-06 Identities = 24/40 (60%), Positives = 27/40 (67%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPR 558 ARRLSWVTPGFSQSRRCKTT +L ++ R PR Sbjct: 49 ARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPR 85 >SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 48.4 bits (110), Expect = 5e-06 Identities = 24/40 (60%), Positives = 27/40 (67%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPR 558 ARRLSWVTPGFSQSRRCKTT +L ++ R PR Sbjct: 49 ARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPR 85 >SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2) Length = 122 Score = 48.4 bits (110), Expect = 5e-06 Identities = 24/40 (60%), Positives = 27/40 (67%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPR 558 ARRLSWVTPGFSQSRRCKTT +L ++ R PR Sbjct: 27 ARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPR 63 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 48.0 bits (109), Expect = 7e-06 Identities = 23/40 (57%), Positives = 26/40 (65%) Frame = +1 Query: 559 RGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 RG P+ ++ VVLQRRDWENPGVTQLNRLA Sbjct: 1 RGEYGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLA 40 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 48.0 bits (109), Expect = 7e-06 Identities = 23/41 (56%), Positives = 26/41 (63%) Frame = +1 Query: 556 ARGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 A G P+ ++ VVLQRRDWENPGVTQLNRLA Sbjct: 28 AERGVGDPLESSCRHASLALDVVLQRRDWENPGVTQLNRLA 68 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 48.0 bits (109), Expect = 7e-06 Identities = 24/45 (53%), Positives = 27/45 (60%) Frame = +1 Query: 544 RRLTARGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 RR A P+ ++ VVLQRRDWENPGVTQLNRLA Sbjct: 17 RRSNGPVAAGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLA 61 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 48.0 bits (109), Expect = 7e-06 Identities = 22/36 (61%), Positives = 25/36 (69%) Frame = +1 Query: 571 RYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 R P+ ++ VVLQRRDWENPGVTQLNRLA Sbjct: 94 RDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLA 129 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 48.0 bits (109), Expect = 7e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ 612 ARRLSWVTPGFSQSRRCKTT + Sbjct: 209 ARRLSWVTPGFSQSRRCKTTAK 230 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 619 VVLQRRDWENPGVTQLNRLA 678 VVLQRRDWEN GVTQLNRLA Sbjct: 517 VVLQRRDWENTGVTQLNRLA 536 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 48.0 bits (109), Expect = 7e-06 Identities = 24/42 (57%), Positives = 27/42 (64%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPRAV 552 ARRLSWVTPGFSQSRRCKTT +L ++ R P V Sbjct: 815 ARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPNCV 853 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 48.0 bits (109), Expect = 7e-06 Identities = 22/35 (62%), Positives = 27/35 (77%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGY 573 ARRLSWVTPGFSQSRRCKTT +L++ ++ Y Sbjct: 62 ARRLSWVTPGFSQSRRCKTTAS---AKLSVMQVDY 93 >SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) Length = 742 Score = 48.0 bits (109), Expect = 7e-06 Identities = 29/58 (50%), Positives = 35/58 (60%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPRAVSLR*QQLASPLCCLHL 504 ARRLSWVTPGFSQSRRCKTT + L + G +P + S + Q A+ LHL Sbjct: 512 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRG--SPKQGKSNKEVQNANLQTPLHL 567 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 48.0 bits (109), Expect = 7e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = +1 Query: 595 SRITIHWPVVLQRRDWENPGVTQLNRLA 678 SRITIHWP WENPGVTQLNRLA Sbjct: 2 SRITIHWPSFYNVVHWENPGVTQLNRLA 29 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 48.0 bits (109), Expect = 7e-06 Identities = 25/52 (48%), Positives = 30/52 (57%), Gaps = 2/52 (3%) Frame = +1 Query: 529 ASCCYRRLTARGGARY--PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 AS Y++ R P+ ++ VVLQRRDWENPGVTQLNRLA Sbjct: 27 ASSAYQKWPTRNSHSLGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLA 78 >SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 48.0 bits (109), Expect = 7e-06 Identities = 25/46 (54%), Positives = 28/46 (60%) Frame = +1 Query: 541 YRRLTARGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 YR R G P+ ++ VVLQRRDWENPGVTQLNRLA Sbjct: 36 YRPRAVRPGD--PLESTCRHASLALAVVLQRRDWENPGVTQLNRLA 79 >SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 48.0 bits (109), Expect = 7e-06 Identities = 23/42 (54%), Positives = 28/42 (66%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPRAV 552 ARRLSWVTPGFSQSRRCKTT +L ++ R P+ + Sbjct: 27 ARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPKII 65 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 48.0 bits (109), Expect = 7e-06 Identities = 22/36 (61%), Positives = 25/36 (69%) Frame = +1 Query: 571 RYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 R P+ ++ VVLQRRDWENPGVTQLNRLA Sbjct: 57 RDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLA 92 >SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) Length = 220 Score = 48.0 bits (109), Expect = 7e-06 Identities = 36/103 (34%), Positives = 49/103 (47%), Gaps = 6/103 (5%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAP----PRAV--SLR*QQLASPLC 516 ARRLSWVTPGFSQSRRCKTT + L + G P P A SL+ + S Sbjct: 27 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPYPAAVKPAAAESSLKGRDSFSRDL 86 Query: 515 CLHLLYINKKILVKSCSLSSHLVIELNILYSVFDMYIRAVIVI 387 C + Y+ + S + H +L ++ I ++VI Sbjct: 87 CQAVGYLGYTLFFTSLIKTRHFTRRACLLMTLGAWLISIILVI 129 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 48.0 bits (109), Expect = 7e-06 Identities = 24/41 (58%), Positives = 26/41 (63%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPRA 555 ARRLSWVTPGFSQSRRCKTT + L + G P A Sbjct: 49 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPVVPAA 89 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 48.0 bits (109), Expect = 7e-06 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPRAVS 549 ARRLSWVTPGFSQSRRCKTT +L ++ R P +S Sbjct: 49 ARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPCVIS 88 >SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 48.0 bits (109), Expect = 7e-06 Identities = 26/45 (57%), Positives = 29/45 (64%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPRAVSLR 543 ARRLSWVTPGFSQSRRCKTT + L + G +P R LR Sbjct: 27 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRG--SPDRTKLLR 69 >SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 48.0 bits (109), Expect = 7e-06 Identities = 25/43 (58%), Positives = 28/43 (65%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPRAVS 549 ARRLSWVTPGFSQSRRCKTT +L ++ R P VS Sbjct: 27 ARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPLDVS 66 >SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) Length = 2049 Score = 48.0 bits (109), Expect = 7e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ 612 ARRLSWVTPGFSQSRRCKTT + Sbjct: 1879 ARRLSWVTPGFSQSRRCKTTAK 1900 >SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) Length = 511 Score = 48.0 bits (109), Expect = 7e-06 Identities = 26/54 (48%), Positives = 30/54 (55%) Frame = +1 Query: 517 HKGDASCCYRRLTARGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 H+ SCC G A + ++ VVLQRRDWENPGVTQLNRLA Sbjct: 90 HRQRGSCC-------GNACRHVESTCRHASLALAVVLQRRDWENPGVTQLNRLA 136 >SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) Length = 800 Score = 48.0 bits (109), Expect = 7e-06 Identities = 23/37 (62%), Positives = 26/37 (70%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRA 567 ARRLSWVTPGFSQSRRCKTT + L + G R+ Sbjct: 292 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSRS 328 >SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 48.0 bits (109), Expect = 7e-06 Identities = 22/36 (61%), Positives = 25/36 (69%) Frame = +1 Query: 571 RYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 R P+ ++ VVLQRRDWENPGVTQLNRLA Sbjct: 7 RDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLA 42 >SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 48.0 bits (109), Expect = 7e-06 Identities = 24/51 (47%), Positives = 28/51 (54%) Frame = +1 Query: 526 DASCCYRRLTARGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 D S Y + P+ ++ VVLQRRDWENPGVTQLNRLA Sbjct: 38 DQSVSYYQWETSDDGGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLA 88 >SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 48.0 bits (109), Expect = 7e-06 Identities = 22/36 (61%), Positives = 25/36 (69%) Frame = +1 Query: 571 RYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 R P+ ++ VVLQRRDWENPGVTQLNRLA Sbjct: 10 RDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLA 45 >SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) Length = 629 Score = 48.0 bits (109), Expect = 7e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ 612 ARRLSWVTPGFSQSRRCKTT + Sbjct: 489 ARRLSWVTPGFSQSRRCKTTAR 510 >SB_1099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 48.0 bits (109), Expect = 7e-06 Identities = 26/52 (50%), Positives = 30/52 (57%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPRAVSLR*QQLASP 522 ARRLSWVTPGFSQSRRCKTT +L ++ R P V +L P Sbjct: 27 ARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPGTVISDINRLVKP 75 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 502 ARRLSWVTPGFSQSRRCKTT 521 >SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 49 ARRLSWVTPGFSQSRRCKTT 68 >SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) Length = 212 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 172 ARRLSWVTPGFSQSRRCKTT 191 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 34 ARRLSWVTPGFSQSRRCKTT 53 >SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 47.6 bits (108), Expect = 9e-06 Identities = 24/45 (53%), Positives = 28/45 (62%) Frame = +1 Query: 544 RRLTARGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 RR+ G P+ ++ VVLQRRDWENPGVTQLNRLA Sbjct: 8 RRIVRHGD---PLESTCRHASLALAVVLQRRDWENPGVTQLNRLA 49 >SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 249 ARRLSWVTPGFSQSRRCKTT 268 >SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 393 ARRLSWVTPGFSQSRRCKTT 412 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 246 ARRLSWVTPGFSQSRRCKTT 265 >SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 95 ARRLSWVTPGFSQSRRCKTT 114 >SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 49 ARRLSWVTPGFSQSRRCKTT 68 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 676 ARRLSWVTPGFSQSRRCKTT 695 >SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 914 ARRLSWVTPGFSQSRRCKTT 933 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 829 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 182 ARRLSWVTPGFSQSRRCKTT 201 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 49 ARRLSWVTPGFSQSRRCKTT 68 >SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 26 ARRLSWVTPGFSQSRRCKTT 45 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 401 ARRLSWVTPGFSQSRRCKTT 420 >SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) Length = 388 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) Length = 305 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 250 ARRLSWVTPGFSQSRRCKTT 269 >SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 317 ARRLSWVTPGFSQSRRCKTT 336 >SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) Length = 154 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 49 ARRLSWVTPGFSQSRRCKTT 68 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 585 ARRLSWVTPGFSQSRRCKTT 604 >SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) Length = 666 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 432 ARRLSWVTPGFSQSRRCKTT 451 >SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 383 ARRLSWVTPGFSQSRRCKTT 402 >SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) Length = 128 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) Length = 794 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 49 ARRLSWVTPGFSQSRRCKTT 68 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 49 ARRLSWVTPGFSQSRRCKTT 68 >SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 59 ARRLSWVTPGFSQSRRCKTT 78 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 75 ARRLSWVTPGFSQSRRCKTT 94 >SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 49 ARRLSWVTPGFSQSRRCKTT 68 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 47.6 bits (108), Expect = 9e-06 Identities = 25/54 (46%), Positives = 30/54 (55%) Frame = +1 Query: 517 HKGDASCCYRRLTARGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 H D S + + G P+ ++ VVLQRRDWENPGVTQLNRLA Sbjct: 3 HLSDRSRLHFHFASEGD---PLESTCRHASLALAVVLQRRDWENPGVTQLNRLA 53 >SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 95 ARRLSWVTPGFSQSRRCKTT 114 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 34 ARRLSWVTPGFSQSRRCKTT 53 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 41 ARRLSWVTPGFSQSRRCKTT 60 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 34 ARRLSWVTPGFSQSRRCKTT 53 Score = 46.4 bits (105), Expect = 2e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +1 Query: 619 VVLQRRDWENPGVTQLNRLA 678 VVLQRRDWENPGVTQLNRLA Sbjct: 87 VVLQRRDWENPGVTQLNRLA 106 >SB_29477| Best HMM Match : Antistasin (HMM E-Value=9.2) Length = 73 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) Length = 214 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 47.6 bits (108), Expect = 9e-06 Identities = 23/41 (56%), Positives = 26/41 (63%) Frame = +1 Query: 556 ARGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 A G P+ ++ VVLQRRDWENPGVTQLNRLA Sbjct: 44 AAGRQGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLA 84 >SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 534 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 397 ARRLSWVTPGFSQSRRCKTT 416 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 34 ARRLSWVTPGFSQSRRCKTT 53 >SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) Length = 1232 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 1131 ARRLSWVTPGFSQSRRCKTT 1150 >SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) Length = 412 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 322 ARRLSWVTPGFSQSRRCKTT 341 >SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1758 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 136 ARRLSWVTPGFSQSRRCKTT 155 >SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 46 ARRLSWVTPGFSQSRRCKTT 65 >SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_24322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 8 ARRLSWVTPGFSQSRRCKTT 27 >SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 20 ARRLSWVTPGFSQSRRCKTT 39 >SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) Length = 466 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 49 ARRLSWVTPGFSQSRRCKTT 68 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 34 ARRLSWVTPGFSQSRRCKTT 53 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 49 ARRLSWVTPGFSQSRRCKTT 68 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 57 ARRLSWVTPGFSQSRRCKTT 76 >SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 49 ARRLSWVTPGFSQSRRCKTT 68 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 49 ARRLSWVTPGFSQSRRCKTT 68 >SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 49 ARRLSWVTPGFSQSRRCKTT 68 >SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 41 ARRLSWVTPGFSQSRRCKTT 60 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 49 ARRLSWVTPGFSQSRRCKTT 68 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 293 ARRLSWVTPGFSQSRRCKTT 312 >SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 277 ARRLSWVTPGFSQSRRCKTT 296 >SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) Length = 184 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 120 ARRLSWVTPGFSQSRRCKTT 139 >SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 80 ARRLSWVTPGFSQSRRCKTT 99 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 47.6 bits (108), Expect = 9e-06 Identities = 25/45 (55%), Positives = 29/45 (64%) Frame = +1 Query: 544 RRLTARGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 RR A+G P+ ++ VVLQRRDWENPGVTQLNRLA Sbjct: 42 RRHDAQGD---PLESTCRHASLALAVVLQRRDWENPGVTQLNRLA 83 >SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 82 ARRLSWVTPGFSQSRRCKTT 101 >SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 49 ARRLSWVTPGFSQSRRCKTT 68 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 47.6 bits (108), Expect = 9e-06 Identities = 24/47 (51%), Positives = 29/47 (61%) Frame = +1 Query: 538 CYRRLTARGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLA 678 C ++R G P+ ++ VVLQRRDWENPGVTQLNRLA Sbjct: 32 CVAAHSSRSGD--PLESTCRHASLALAVVLQRRDWENPGVTQLNRLA 76 >SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 556 ARRLSWVTPGFSQSRRCKTT 575 >SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 76 ARRLSWVTPGFSQSRRCKTT 95 >SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) Length = 90 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) Length = 542 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 181 ARRLSWVTPGFSQSRRCKTT 200 >SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) Length = 546 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 49 ARRLSWVTPGFSQSRRCKTT 68 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 49 ARRLSWVTPGFSQSRRCKTT 68 >SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 49 ARRLSWVTPGFSQSRRCKTT 68 >SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 49 ARRLSWVTPGFSQSRRCKTT 68 >SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 41 ARRLSWVTPGFSQSRRCKTT 60 >SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 266 ARRLSWVTPGFSQSRRCKTT 285 >SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 291 ARRLSWVTPGFSQSRRCKTT 310 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 49 ARRLSWVTPGFSQSRRCKTT 68 >SB_55182| Best HMM Match : T4_deiodinase (HMM E-Value=0) Length = 446 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 64 ARRLSWVTPGFSQSRRCKTT 83 >SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 49 ARRLSWVTPGFSQSRRCKTT 68 >SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) Length = 316 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 27 ARRLSWVTPGFSQSRRCKTT 46 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 218 ARRLSWVTPGFSQSRRCKTT 237 >SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 154 ARRLSWVTPGFSQSRRCKTT 173 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 677 ARRLSWVTPGFSQSRRCKTT 618 ARRLSWVTPGFSQSRRCKTT Sbjct: 49 ARRLSWVTPGFSQSRRCKTT 68 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,715,452 Number of Sequences: 59808 Number of extensions: 306893 Number of successful extensions: 3387 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3327 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3370 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -