Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0206
         (678 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK128048-1|BAC87250.1|  198|Homo sapiens protein ( Homo sapiens ...    32   2.2  

>AK128048-1|BAC87250.1|  198|Homo sapiens protein ( Homo sapiens
           cDNA FLJ46168 fis, clone TESTI4003279. ).
          Length = 198

 Score = 31.9 bits (69), Expect = 2.2
 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 2/38 (5%)
 Frame = +1

Query: 514 QHKGDASCCYRRLTARGGAR--YPIRPIVSRITIHWPV 621
           QH   ASCC       GG+R   P  P+V  +  HWP+
Sbjct: 63  QHPTQASCCCHTSAPPGGSRGQDPRGPLVGALCQHWPM 100


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 82,347,282
Number of Sequences: 237096
Number of extensions: 1429975
Number of successful extensions: 5629
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 5611
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5629
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 7671262118
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)