BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0194 (692 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1786.02 |||phospholipase |Schizosaccharomyces pombe|chr 1|||... 30 0.28 SPAC17A5.11 |rec12|spo11|endonuclease Rec12|Schizosaccharomyces ... 28 1.1 SPAC15A10.11 |ubr11||N-end-recognizing protein |Schizosaccharomy... 27 1.9 SPCC1223.01 ||SPCC285.18|ubiquitin-protein ligase E3 |Schizosacc... 27 3.4 SPAC9G1.06c |cyk3||cytokinesis protein Cyk3|Schizosaccharomyces ... 26 5.9 >SPAC1786.02 |||phospholipase |Schizosaccharomyces pombe|chr 1|||Manual Length = 644 Score = 30.3 bits (65), Expect = 0.28 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 629 FWGRGALKHLIGTLKGAPDL 688 +WGR +H +G L+G P+L Sbjct: 227 YWGRAIARHFVGQLRGGPNL 246 >SPAC17A5.11 |rec12|spo11|endonuclease Rec12|Schizosaccharomyces pombe|chr 1|||Manual Length = 345 Score = 28.3 bits (60), Expect = 1.1 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -2 Query: 619 RVMVHVVGHRPDRRFFAL*RWSPRSLIVDSCSK 521 + +V + PD +FF + W P L + SC K Sbjct: 210 KFLVKLAKALPDAKFFGIFDWDPHGLCIYSCFK 242 >SPAC15A10.11 |ubr11||N-end-recognizing protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 2052 Score = 27.5 bits (58), Expect = 1.9 Identities = 21/52 (40%), Positives = 25/52 (48%) Frame = +3 Query: 426 VKSAHFLTNRPKSAKSLINQKNRPR*GWCCSSLEQESTIKERGLQRQRAKNR 581 VK FLTN + SL+ Q NRP S +E TI+ L RQ K R Sbjct: 675 VKDYDFLTNLNATTLSLLTQSNRPS-TLFSSDIEYTPTIQ---LNRQVLKTR 722 >SPCC1223.01 ||SPCC285.18|ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 732 Score = 26.6 bits (56), Expect = 3.4 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 296 PPFASWRNSEEARTDRPSQQLRSLN 370 PP AS RN E + PS+Q S+N Sbjct: 353 PPGASGRNRRERTSSTPSEQSTSVN 377 >SPAC9G1.06c |cyk3||cytokinesis protein Cyk3|Schizosaccharomyces pombe|chr 1|||Manual Length = 886 Score = 25.8 bits (54), Expect = 5.9 Identities = 16/60 (26%), Positives = 26/60 (43%) Frame = +3 Query: 426 VKSAHFLTNRPKSAKSLINQKNRPR*GWCCSSLEQESTIKERGLQRQRAKNRLSGRWPTT 605 V S++ L + + SL +QK+ P SSL + ++ R +S RW T Sbjct: 110 VGSSNALNKPTRESDSLKHQKSHPMLNSLGSSLSLKKSVSRPPSSMSRTNLDVSSRWDNT 169 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,725,005 Number of Sequences: 5004 Number of extensions: 55717 Number of successful extensions: 99 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 95 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 99 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 321951680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -