BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0194 (692 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g19230.1 68414.m02393 respiratory burst oxidase protein E (Rb... 30 1.3 At5g12890.1 68418.m01479 UDP-glucoronosyl/UDP-glucosyl transfera... 28 6.8 At3g15070.1 68416.m01906 zinc finger (C3HC4-type RING finger) fa... 28 6.8 >At1g19230.1 68414.m02393 respiratory burst oxidase protein E (RbohE) / NADPH oxidase nearly identical to respiratory burst oxidase protein E GI:3242787 [gi:3242787] from [Arabidopsis thaliana] Length = 926 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = +2 Query: 548 TWTPTSK--GEKPSIRAMAHYVNHHPNQIFWGRGALKHL 658 T TPTS G+K +++A ++V P + W RG ++ + Sbjct: 777 TATPTSTHGGKKKAVKAHFYWVTREPGSVEWFRGVMEEI 815 >At5g12890.1 68418.m01479 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 488 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 Query: 502 RVGVVPVWNKSPLLKNVDSNVKGRKT 579 R+ VPVW P+LK+ D V R T Sbjct: 244 RITGVPVWPVGPVLKSPDKKVGSRST 269 >At3g15070.1 68416.m01906 zinc finger (C3HC4-type RING finger) family protein similar to C-terminal zinc-finger [Glycine max] GI:558543; contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 486 Score = 27.9 bits (59), Expect = 6.8 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +2 Query: 554 TPTSKGEKPSIRAMAHYVNHHP 619 T +S+ PS+ HY++HHP Sbjct: 260 TSSSRNPTPSVYQRNHYISHHP 281 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,377,768 Number of Sequences: 28952 Number of extensions: 295920 Number of successful extensions: 594 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 584 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 594 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1477286152 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -