BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0192 (600 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 107 9e-24 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 107 9e-24 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 107 9e-24 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 3e-21 SB_33031| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) 97 7e-21 SB_37381| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) 90 1e-18 SB_25288| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 5e-15 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 8e-14 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 1e-13 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 71 1e-12 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_51819| Best HMM Match : TGF_beta (HMM E-Value=1.9) 70 1e-12 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 69 3e-12 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 69 3e-12 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_50727| Best HMM Match : adh_short (HMM E-Value=8.9e-08) 67 9e-12 SB_45128| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_51573| Best HMM Match : UCR_TM (HMM E-Value=6.7) 66 2e-11 SB_31286| Best HMM Match : HEAT (HMM E-Value=0.092) 66 2e-11 SB_26800| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 66 2e-11 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 66 2e-11 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 66 2e-11 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 66 2e-11 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 66 2e-11 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 66 2e-11 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 66 2e-11 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 66 2e-11 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 66 2e-11 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 66 2e-11 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 66 2e-11 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 66 2e-11 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 66 2e-11 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 66 2e-11 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 66 2e-11 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 66 2e-11 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 66 2e-11 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 66 2e-11 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 66 2e-11 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 66 2e-11 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 66 2e-11 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 66 2e-11 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 66 2e-11 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 66 2e-11 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 66 2e-11 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 66 2e-11 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 66 2e-11 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 66 2e-11 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 66 2e-11 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 66 2e-11 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 66 2e-11 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 66 2e-11 SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_56291| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 66 2e-11 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 66 2e-11 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 66 2e-11 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 66 2e-11 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 66 2e-11 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 66 2e-11 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 66 2e-11 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 66 2e-11 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 66 2e-11 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 66 2e-11 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 66 2e-11 SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 66 2e-11 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 66 2e-11 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 66 2e-11 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 66 2e-11 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 66 2e-11 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 66 2e-11 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 66 2e-11 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 66 2e-11 SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) 66 2e-11 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 65 4e-11 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 65 4e-11 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 65 4e-11 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 65 4e-11 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 65 4e-11 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_50436| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_20169| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_213| Best HMM Match : rve (HMM E-Value=2.2e-08) 65 4e-11 SB_42166| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 5e-11 SB_53831| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 5e-11 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 5e-11 SB_29088| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 5e-11 SB_18115| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 5e-11 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 6e-11 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 64 6e-11 SB_23924| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 6e-11 SB_49917| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 8e-11 SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 8e-11 SB_39027| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 8e-11 SB_29218| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 8e-11 SB_27913| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 8e-11 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 8e-11 SB_55058| Best HMM Match : HLH (HMM E-Value=1.4e-05) 64 8e-11 SB_48721| Best HMM Match : TorD (HMM E-Value=5.3) 64 8e-11 SB_45332| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 8e-11 SB_25859| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 8e-11 SB_25110| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 8e-11 SB_17822| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 8e-11 SB_10411| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 8e-11 SB_5248| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 8e-11 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_59099| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_59056| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_59022| Best HMM Match : Pkinase_Tyr (HMM E-Value=2.4e-13) 64 1e-10 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58938| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58787| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58740| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58562| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58322| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 64 1e-10 SB_58087| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57919| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57765| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 64 1e-10 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 64 1e-10 SB_57517| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57244| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57238| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 64 1e-10 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56899| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56712| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 64 1e-10 SB_56631| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 64 1e-10 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55775| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55081| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_54479| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 64 1e-10 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 64 1e-10 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 64 1e-10 SB_54117| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_54116| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_54092| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_54086| Best HMM Match : Phage_integrase (HMM E-Value=0.68) 64 1e-10 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 64 1e-10 SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_53629| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_53123| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52872| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52828| Best HMM Match : Apidaecin (HMM E-Value=4.5) 64 1e-10 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 64 1e-10 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52419| Best HMM Match : Drf_DAD (HMM E-Value=2.5) 64 1e-10 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 64 1e-10 SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_51754| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) 64 1e-10 SB_51567| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 64 1e-10 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_51356| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_51272| Best HMM Match : SMC_hinge (HMM E-Value=6.3) 64 1e-10 SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 64 1e-10 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_51070| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_50749| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 64 1e-10 SB_50634| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_50512| Best HMM Match : Kelch_1 (HMM E-Value=0.17) 64 1e-10 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_50488| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_50482| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_50012| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49975| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49901| Best HMM Match : DoxX (HMM E-Value=6.2) 64 1e-10 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49761| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49678| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49547| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49509| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49332| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 64 1e-10 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 64 1e-10 SB_48922| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_48921| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_48840| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_48531| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_48210| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_48116| Best HMM Match : Flu_NS2 (HMM E-Value=9.1) 64 1e-10 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 64 1e-10 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 107 bits (256), Expect = 9e-24 Identities = 51/63 (80%), Positives = 51/63 (80%) Frame = -3 Query: 586 HSPFRLRNCWEGRSVRASSLLRQLAKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYR 407 HSPFRLRNCWEGRSVRASSLLRQLAKG GFPSHDVVKRRPVNCNTTHYR Sbjct: 589 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAAR---RLSWGFPSHDVVKRRPVNCNTTHYR 645 Query: 406 ANW 398 ANW Sbjct: 646 ANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 107 bits (256), Expect = 9e-24 Identities = 51/63 (80%), Positives = 51/63 (80%) Frame = -3 Query: 586 HSPFRLRNCWEGRSVRASSLLRQLAKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYR 407 HSPFRLRNCWEGRSVRASSLLRQLAKG GFPSHDVVKRRPVNCNTTHYR Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAAR---RLSWGFPSHDVVKRRPVNCNTTHYR 88 Query: 406 ANW 398 ANW Sbjct: 89 ANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 107 bits (256), Expect = 9e-24 Identities = 51/63 (80%), Positives = 51/63 (80%) Frame = -3 Query: 586 HSPFRLRNCWEGRSVRASSLLRQLAKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYR 407 HSPFRLRNCWEGRSVRASSLLRQLAKG GFPSHDVVKRRPVNCNTTHYR Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAAR---RLSWGFPSHDVVKRRPVNCNTTHYR 88 Query: 406 ANW 398 ANW Sbjct: 89 ANW 91 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 98.7 bits (235), Expect = 3e-21 Identities = 46/59 (77%), Positives = 47/59 (79%) Frame = -3 Query: 574 RLRNCWEGRSVRASSLLRQLAKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 398 +LRNCWEGRSVRASSLLRQLAKG GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 22 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_33031| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) Length = 143 Score = 97.5 bits (232), Expect = 7e-21 Identities = 44/49 (89%), Positives = 49/49 (100%) Frame = -1 Query: 255 QENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 109 +ENDEVL++GFGR+GHAVGDIPGVRFKVVKVANVSLLAL+KEKKERPRS Sbjct: 95 EENDEVLISGFGRRGHAVGDIPGVRFKVVKVANVSLLALFKEKKERPRS 143 Score = 82.6 bits (195), Expect = 2e-16 Identities = 36/44 (81%), Positives = 42/44 (95%) Frame = -2 Query: 380 EKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIKK 249 ++ GVEAKQPNSAIRKCVRVQLIKNGKK+TAFVP DGCLN+I++ Sbjct: 53 QEPGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNYIEE 96 >SB_37381| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) Length = 413 Score = 89.8 bits (213), Expect = 1e-18 Identities = 41/48 (85%), Positives = 45/48 (93%) Frame = -2 Query: 392 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIKK 249 G LEKVGVEAKQPNSAIRKCVRVQLIKNGKK+TAFVP DGCLN+I++ Sbjct: 48 GIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNYIEE 95 Score = 50.4 bits (115), Expect = 1e-06 Identities = 19/24 (79%), Positives = 24/24 (100%) Frame = -1 Query: 255 QENDEVLVAGFGRKGHAVGDIPGV 184 +ENDEVL++GFGR+GHAVGDIPG+ Sbjct: 94 EENDEVLISGFGRRGHAVGDIPGI 117 >SB_25288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 83.0 bits (196), Expect = 2e-16 Identities = 41/52 (78%), Positives = 41/52 (78%) Frame = -2 Query: 587 PFAIQAAQLLGRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTAS 432 PFAIQAA LLGRAIGAGLF ITPA ERG ARRLSWV P FSQS RC AS Sbjct: 6 PFAIQAAHLLGRAIGAGLFDITPACERGMCARRLSWVMPAFSQSSRCIMAAS 57 >SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 78.2 bits (184), Expect = 5e-15 Identities = 40/52 (76%), Positives = 40/52 (76%) Frame = -3 Query: 586 HSPFRLRNCWEGRSVRASSLLRQLAKGDVLQGD*VG*RQGFPSHDVVKRRPV 431 HSPFRLRNCWEGRSVRASSLLRQLAKG GFPSHDVVKRRPV Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAAR---RLSWGFPSHDVVKRRPV 67 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 77.8 bits (183), Expect = 6e-15 Identities = 35/39 (89%), Positives = 36/39 (92%), Gaps = 1/39 (2%) Frame = -3 Query: 511 KGDVLQGD*-VG*RQGFPSHDVVKRRPVNCNTTHYRANW 398 KGDVLQGD +G RQGFPSHDVVKRRPVNCNTTHYRANW Sbjct: 64 KGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 Score = 50.0 bits (114), Expect = 1e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -2 Query: 575 QAAQLLGRAIGAGLFAITPAGERG 504 QAAQLLGRAIGAGLFAITPAGE+G Sbjct: 42 QAAQLLGRAIGAGLFAITPAGEKG 65 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 75.8 bits (178), Expect = 3e-14 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +2 Query: 401 IRPIVSRITIHWPSFYNVVTGKTLALPNLIALQHIP 508 +RP+VSRITIHW SFYNVVTGKTLALPNLIALQHIP Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIP 68 Score = 45.2 bits (102), Expect = 4e-05 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +3 Query: 528 SEEARTDRPSQQLRSLNGEW 587 +EEARTDRPSQQLRSLNGEW Sbjct: 76 AEEARTDRPSQQLRSLNGEW 95 >SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 74.1 bits (174), Expect = 8e-14 Identities = 38/56 (67%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = -2 Query: 596 YNLPFAIQAAQLL-GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTAS 432 + PFAIQAAQLL GR++ A + + GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 HQAPFAIQAAQLLEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 73.3 bits (172), Expect = 1e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +2 Query: 407 PIVSRITIHWPSFYNVVTGKTLALPNLIALQHIP 508 P +SRITIHWPSFYNVVTGKTLALPNLIALQHIP Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIALQHIP 110 Score = 44.8 bits (101), Expect = 5e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +3 Query: 531 EEARTDRPSQQLRSLNGEW 587 EEARTDRPSQQLRSLNGEW Sbjct: 119 EEARTDRPSQQLRSLNGEW 137 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 71.7 bits (168), Expect = 4e-13 Identities = 37/56 (66%), Positives = 42/56 (75%), Gaps = 1/56 (1%) Frame = -2 Query: 596 YNLPFAIQAAQLL-GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTAS 432 + PFAIQAAQL GR++ A + + GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 HQAPFAIQAAQLWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 71.7 bits (168), Expect = 4e-13 Identities = 37/56 (66%), Positives = 42/56 (75%), Gaps = 1/56 (1%) Frame = -2 Query: 596 YNLPFAIQAAQLL-GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTAS 432 + PFAIQAAQL GR++ A + + GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 HQAPFAIQAAQLWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 70.5 bits (165), Expect = 1e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 416 SRITIHWPSFYNVVTGKTLALPNLIALQHIP 508 SRITIHWPSFYNVVTGKTLALPNLIALQHIP Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIP 32 Score = 63.7 bits (148), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEW 587 PFASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 33 PFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 70.5 bits (165), Expect = 1e-12 Identities = 37/63 (58%), Positives = 37/63 (58%) Frame = -3 Query: 586 HSPFRLRNCWEGRSVRASSLLRQLAKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYR 407 HSPFRLRNCWEG R GFPSHDVVKRRPVNCNTTHYR Sbjct: 43 HSPFRLRNCWEG-------------------------RSGFPSHDVVKRRPVNCNTTHYR 77 Query: 406 ANW 398 ANW Sbjct: 78 ANW 80 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 70.5 bits (165), Expect = 1e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 416 SRITIHWPSFYNVVTGKTLALPNLIALQHIP 508 SRITIHWPSFYNVVTGKTLALPNLIALQHIP Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIP 32 Score = 48.8 bits (111), Expect = 3e-06 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +3 Query: 525 NSEEARTDRPSQQLRSLNGEW 587 NSEEARTDRPSQQLRSLNGEW Sbjct: 39 NSEEARTDRPSQQLRSLNGEW 59 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 70.5 bits (165), Expect = 1e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 416 SRITIHWPSFYNVVTGKTLALPNLIALQHIP 508 SRITIHWPSFYNVVTGKTLALPNLIALQHIP Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIP 32 Score = 40.7 bits (91), Expect = 9e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +1 Query: 505 PLSPAGVIAKRPAPIALP 558 PLSPAGVIAKRPAPIALP Sbjct: 32 PLSPAGVIAKRPAPIALP 49 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 70.1 bits (164), Expect = 1e-12 Identities = 34/56 (60%), Positives = 39/56 (69%) Frame = +3 Query: 432 TGRRFTTS*LGKPWRYPT*SPCSTSPFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 TGRRFT P + PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 40 TGRRFTRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 95 >SB_51819| Best HMM Match : TGF_beta (HMM E-Value=1.9) Length = 696 Score = 70.1 bits (164), Expect = 1e-12 Identities = 38/60 (63%), Positives = 40/60 (66%), Gaps = 5/60 (8%) Frame = +3 Query: 423 LQFTGRRFTTS*LGKP----WRY-PT*SPCSTSPFASWRNSEEARTDRPSQQLRSLNGEW 587 L F GR +S P +RY P S C PFASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 248 LSFNGRVIVSSDSATPTLVNFRYCPFVSGCPHPPFASWRNSEEARTDRPSQQLRSLNGEW 307 >SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) Length = 126 Score = 68.9 bits (161), Expect = 3e-12 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = +3 Query: 468 PWRYPT*SPCSTSPFASWRNSEEARTDRPSQQLRSLNGEW 587 P R+ + SP + PFASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 48 PPRWSSNSPYTHPPFASWRNSEEARTDRPSQQLRSLNGEW 87 >SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) Length = 118 Score = 68.9 bits (161), Expect = 3e-12 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -1 Query: 588 AIRHSGCATVGKGDRCGPLRYYASWRKG 505 AIRHSGCATVGKGDRCGPLRYYASWRKG Sbjct: 85 AIRHSGCATVGKGDRCGPLRYYASWRKG 112 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 586 HSPFRLRNCWEGRSVRASSLLRQLAKG 506 HSPFRLRNCWEGRSVRASSLLRQLAKG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 Score = 59.3 bits (137), Expect = 2e-09 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = -2 Query: 557 GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTAS 432 GR++ A + + GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 67.7 bits (158), Expect = 7e-12 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 590 LPFAIQAAQLLGRAIGAGLFAITPAGERGCAARRLSWVTPGF 465 +PFAIQAAQLLGRAIGAGLFAITPAGERG + + VTP F Sbjct: 1836 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLVTPVF 1877 Score = 59.3 bits (137), Expect = 2e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 466 FPSHDVVKRRPVNCNTTHYRANW 398 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 1877 FPSHDVVKRRPVNCNTTHYRANW 1899 >SB_50727| Best HMM Match : adh_short (HMM E-Value=8.9e-08) Length = 272 Score = 67.3 bits (157), Expect = 9e-12 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 585 IRHSGCATVGKGDRCGPLRYYASWRKG 505 IRHSGCATVGKGDRCGPLRYYASWRKG Sbjct: 240 IRHSGCATVGKGDRCGPLRYYASWRKG 266 >SB_45128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 66.9 bits (156), Expect = 1e-11 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +3 Query: 492 PCSTSPFASWRNSEEARTDRPSQQLRSLNGEW 587 P S PFASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 37 PASHPPFASWRNSEEARTDRPSQQLRSLNGEW 68 >SB_51573| Best HMM Match : UCR_TM (HMM E-Value=6.7) Length = 93 Score = 66.5 bits (155), Expect = 2e-11 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = +3 Query: 465 KPWRYPT*SPCSTSPFASWRNSEEARTDRPSQQLRSLNGEW 587 +P P+ S + PFASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 13 RPNPVPSPSDAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 53 >SB_31286| Best HMM Match : HEAT (HMM E-Value=0.092) Length = 1270 Score = 66.5 bits (155), Expect = 2e-11 Identities = 32/52 (61%), Positives = 39/52 (75%) Frame = -2 Query: 590 LPFAIQAAQLLGRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTA 435 +PFAIQAAQLLGRAIGAGLFAITPAGERG + + TP ++R+ T+ Sbjct: 1122 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLDTPSSPRARKFGETS 1173 >SB_26800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 66.5 bits (155), Expect = 2e-11 Identities = 33/48 (68%), Positives = 36/48 (75%), Gaps = 1/48 (2%) Frame = +2 Query: 446 YNVVTGKTLALPNLIALQHIP-FRQLA**RRGPHRSPFPTVAQPEWRM 586 Y+VVTGKTLA+P+L ALQHIP F R PHRSPFP AQPEWRM Sbjct: 13 YDVVTGKTLAVPSLNALQHIPHFASWRTYPRSPHRSPFPRDAQPEWRM 60 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 87 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 117 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHP 86 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 50 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 80 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHP 49 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 74 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 104 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHP 73 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 53 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 83 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHP 52 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 858 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 888 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 833 LAVVLQRRDWENPGVTQLNRLAAHP 857 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 139 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 169 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHP 138 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 64 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 94 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHP 63 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 36 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 66 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHP 35 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 113 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 143 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHP 112 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 47 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 77 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHP 46 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 178 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 208 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 153 LAVVLQRRDWENPGVTQLNRLAAHP 177 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 82 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 112 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHP 81 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 72 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 102 Score = 54.8 bits (126), Expect = 5e-08 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 L VVLQRRDWENPGVTQLNRLAAHP Sbjct: 47 LDVVLQRRDWENPGVTQLNRLAAHP 71 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 85 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 115 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHP 84 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 238 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 268 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 213 LAVVLQRRDWENPGVTQLNRLAAHP 237 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 73 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 103 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHP 72 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 65 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 95 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHP 64 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 100 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 130 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 75 LAVVLQRRDWENPGVTQLNRLAAHP 99 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 47 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 77 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHP 46 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 82 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 112 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHP 81 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 125 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 155 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHP 124 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 98 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 128 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 53 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 83 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHP 52 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 171 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 201 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 146 LAVVLQRRDWENPGVTQLNRLAAHP 170 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 84 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 114 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHP 83 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 113 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 143 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHP 112 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 125 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 155 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHP 124 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 57 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 87 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHP 56 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 150 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 180 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 125 LAVVLQRRDWENPGVTQLNRLAAHP 149 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 121 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 151 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 96 LAVVLQRRDWENPGVTQLNRLAAHP 120 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 86 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 116 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 61 LAVVLQRRDWENPGVTQLNRLAAHP 85 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 109 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 139 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHP 108 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 109 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 139 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHP 108 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 109 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 139 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHP 108 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 90 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 120 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHP 89 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 49 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 79 Score = 57.6 bits (133), Expect = 7e-09 Identities = 31/51 (60%), Positives = 33/51 (64%) Frame = +1 Query: 355 CLASTPTFSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHP 507 C TPT + G P+ LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 1 CSPPTPT-ATGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHP 48 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 133 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 163 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 108 LAVVLQRRDWENPGVTQLNRLAAHP 132 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 49 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 79 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHP 48 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 68 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 98 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHP 67 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 101 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 131 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 76 LAVVLQRRDWENPGVTQLNRLAAHP 100 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 92 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 122 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHP 91 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 116 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 146 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 91 LAVVLQRRDWENPGVTQLNRLAAHP 115 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 66 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 96 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHP 65 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 1088 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 1118 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 1063 LAVVLQRRDWENPGVTQLNRLAAHP 1087 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 159 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 189 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHP 158 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 207 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 237 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 182 LAVVLQRRDWENPGVTQLNRLAAHP 206 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 195 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 225 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 170 LAVVLQRRDWENPGVTQLNRLAAHP 194 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 84 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 114 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHP 83 >SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 60 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 90 Score = 50.8 bits (116), Expect = 8e-07 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +1 Query: 445 LQRRDWENPGVTQLNRLAAHP 507 LQRRDWENPGVTQLNRLAAHP Sbjct: 39 LQRRDWENPGVTQLNRLAAHP 59 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 171 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 201 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 146 LAVVLQRRDWENPGVTQLNRLAAHP 170 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 83 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 113 Score = 57.6 bits (133), Expect = 7e-09 Identities = 30/53 (56%), Positives = 33/53 (62%) Frame = +1 Query: 349 LGCLASTPTFSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHP 507 LG ++ P G P+ LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 32 LGICSAGPIQKEGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHP 82 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 141 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 171 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 116 LAVVLQRRDWENPGVTQLNRLAAHP 140 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 48 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 78 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 23 LAVVLQRRDWENPGVTQLNRLAAHP 47 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 677 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 707 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 652 LAVVLQRRDWENPGVTQLNRLAAHP 676 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 64 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 94 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHP 63 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 186 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 216 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHP 185 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 47 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 77 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHP 46 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 95 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 125 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHP 94 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 96 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 126 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 71 LAVVLQRRDWENPGVTQLNRLAAHP 95 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 104 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 134 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHP 103 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 210 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 240 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 185 LAVVLQRRDWENPGVTQLNRLAAHP 209 >SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) Length = 633 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 469 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 499 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 444 LAVVLQRRDWENPGVTQLNRLAAHP 468 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 98 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 128 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 291 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 321 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 266 LAVVLQRRDWENPGVTQLNRLAAHP 290 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 59 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 89 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 95 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 125 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHP 94 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 129 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 159 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHP 128 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 88 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 118 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHP 87 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 98 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 128 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 98 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 128 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 99 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 129 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 74 LAVVLQRRDWENPGVTQLNRLAAHP 98 >SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 70 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 100 Score = 50.8 bits (116), Expect = 8e-07 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +1 Query: 445 LQRRDWENPGVTQLNRLAAHP 507 LQRRDWENPGVTQLNRLAAHP Sbjct: 49 LQRRDWENPGVTQLNRLAAHP 69 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 108 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 138 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHP 107 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 201 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 231 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 176 LAVVLQRRDWENPGVTQLNRLAAHP 200 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 56 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 86 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHP 55 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 108 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 138 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHP 107 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 74 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 104 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHP 73 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 93 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 123 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHP 92 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 82 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 112 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHP 81 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 94 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 124 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHP 93 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 63 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 93 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHP 62 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 69 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 99 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHP 68 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 87 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 117 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHP 86 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 106 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 136 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHP 105 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 216 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 246 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 191 LAVVLQRRDWENPGVTQLNRLAAHP 215 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 112 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 142 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 87 LAVVLQRRDWENPGVTQLNRLAAHP 111 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 129 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 159 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHP 128 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 63 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 93 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHP 62 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 75 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 105 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHP 74 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 74 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 104 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHP 73 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 151 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 181 Score = 57.6 bits (133), Expect = 7e-09 Identities = 37/81 (45%), Positives = 42/81 (51%), Gaps = 7/81 (8%) Frame = +1 Query: 286 NAVTFFPF-------LMSCTRTHLRMAELGCLASTPTFSRGGPVXXXXXXXXXXXXLAVV 444 N V+F+PF L+ T HLR + G P+ LAVV Sbjct: 72 NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDGDPLESTCRHASLA--LAVV 129 Query: 445 LQRRDWENPGVTQLNRLAAHP 507 LQRRDWENPGVTQLNRLAAHP Sbjct: 130 LQRRDWENPGVTQLNRLAAHP 150 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 94 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 124 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHP 93 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 80 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 110 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHP 79 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 79 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 109 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHP 78 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 113 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 143 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHP 112 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 80 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 110 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHP 79 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 119 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 149 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 94 LAVVLQRRDWENPGVTQLNRLAAHP 118 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 90 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 120 Score = 58.4 bits (135), Expect = 4e-09 Identities = 33/55 (60%), Positives = 34/55 (61%) Frame = +1 Query: 343 AELGCLASTPTFSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHP 507 AE G L F RG P+ LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 38 AEQGRL-DVEAFGRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHP 89 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 192 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 222 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 167 LAVVLQRRDWENPGVTQLNRLAAHP 191 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 104 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 134 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHP 103 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 82 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 112 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHP 81 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 130 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 160 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 105 LAVVLQRRDWENPGVTQLNRLAAHP 129 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 61 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 91 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHP 60 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 144 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 174 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 119 LAVVLQRRDWENPGVTQLNRLAAHP 143 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 177 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 207 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 152 LAVVLQRRDWENPGVTQLNRLAAHP 176 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 127 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 157 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 102 LAVVLQRRDWENPGVTQLNRLAAHP 126 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 59 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 89 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 120 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 150 Score = 54.0 bits (124), Expect = 9e-08 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWEN GVTQLNRLAAHP Sbjct: 95 LAVVLQRRDWENTGVTQLNRLAAHP 119 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 62 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 92 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHP 61 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 94 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 124 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHP 93 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 151 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 181 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 126 LAVVLQRRDWENPGVTQLNRLAAHP 150 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 51 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 81 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHP 50 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 96 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 126 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 71 LAVVLQRRDWENPGVTQLNRLAAHP 95 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 110 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 140 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHP 109 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 118 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 148 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHP 117 >SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 97 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 127 Score = 50.8 bits (116), Expect = 8e-07 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +1 Query: 445 LQRRDWENPGVTQLNRLAAHP 507 LQRRDWENPGVTQLNRLAAHP Sbjct: 76 LQRRDWENPGVTQLNRLAAHP 96 >SB_56291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 434 Score = 66.1 bits (154), Expect = 2e-11 Identities = 35/50 (70%), Positives = 39/50 (78%), Gaps = 2/50 (4%) Frame = -2 Query: 599 LYNLPFAIQAAQLLGRAIGAGLFAITPAGERG--CAARRLSWVTPGFSQS 456 L+ +PFAIQAAQLLGRAIGAGLFAITPAGERG C A +L+ V S S Sbjct: 107 LWRVPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLALVVSVLSSS 156 >SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) Length = 1064 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 816 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 846 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 791 LAVVLQRRDWENPGVTQLNRLAAHP 815 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 97 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 127 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 72 LAVVLQRRDWENPGVTQLNRLAAHP 96 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 118 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 148 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHP 117 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 132 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 162 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 107 LAVVLQRRDWENPGVTQLNRLAAHP 131 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 106 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 136 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHP 105 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 133 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 163 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 108 LAVVLQRRDWENPGVTQLNRLAAHP 132 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 331 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 361 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 306 LAVVLQRRDWENPGVTQLNRLAAHP 330 >SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 77 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 107 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 52 LAVVLQRRDWENPGVTQLNRLAAHP 76 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 40 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 70 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 15 LAVVLQRRDWENPGVTQLNRLAAHP 39 >SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 51 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 81 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHP 50 >SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) Length = 292 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 78 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 108 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHP 77 >SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 81 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 111 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHP 80 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 272 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 302 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 247 LAVVLQRRDWENPGVTQLNRLAAHP 271 >SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 106 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 136 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHP 105 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 59 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 89 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 73 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 103 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHP 72 >SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 49 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 79 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHP 48 >SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 229 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 259 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 204 LAVVLQRRDWENPGVTQLNRLAAHP 228 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 88 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 118 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHP 87 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 744 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 774 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 719 LAVVLQRRDWENPGVTQLNRLAAHP 743 >SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 64 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 94 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHP 63 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 554 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 584 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 529 LAVVLQRRDWENPGVTQLNRLAAHP 553 >SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 551 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 212 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 242 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 187 LAVVLQRRDWENPGVTQLNRLAAHP 211 >SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) Length = 511 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 140 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 170 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 115 LAVVLQRRDWENPGVTQLNRLAAHP 139 >SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 55 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 85 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 30 LAVVLQRRDWENPGVTQLNRLAAHP 54 >SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 45 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 75 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHP 44 >SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 110 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 140 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHP 109 >SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 57 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 87 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHP 56 >SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 134 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 164 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 109 LAVVLQRRDWENPGVTQLNRLAAHP 133 >SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 46 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 76 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHP 45 >SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 62 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 92 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHP 61 >SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) Length = 567 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 223 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 253 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 198 LAVVLQRRDWENPGVTQLNRLAAHP 222 >SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) Length = 132 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 76 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 106 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHP 75 >SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 85 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 115 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHP 84 >SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 46 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 76 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHP 45 >SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 66 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 96 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHP 65 >SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 92 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 122 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHP 91 >SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 69 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 99 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHP 68 >SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 87 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 117 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHP 86 >SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) Length = 191 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 146 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 176 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 121 LAVVLQRRDWENPGVTQLNRLAAHP 145 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 94 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 124 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHP 93 >SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) Length = 940 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 389 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 419 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 364 LAVVLQRRDWENPGVTQLNRLAAHP 388 >SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) Length = 267 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 66 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 96 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHP 65 >SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) Length = 144 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 79 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 109 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHP 78 >SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) Length = 630 Score = 66.1 bits (154), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIVK 599 PFASWRNSEEARTDRPSQQLRSLNGEW++++ Sbjct: 462 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 492 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 437 LAVVLQRRDWENPGVTQLNRLAAHP 461 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 65.7 bits (153), Expect = 3e-11 Identities = 31/33 (93%), Positives = 31/33 (93%), Gaps = 1/33 (3%) Frame = +2 Query: 416 SRITIHWPSFYNVVTGKTLALPNLIALQ-HIPF 511 SRITIHWPSFYNVVTGKTLALPNLIALQ H PF Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQLHPPF 34 Score = 62.1 bits (144), Expect = 3e-10 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEW 587 PFASWRNSEEARTDRPSQ+LRSLNGEW Sbjct: 33 PFASWRNSEEARTDRPSQRLRSLNGEW 59 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 40 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 69 Score = 50.8 bits (116), Expect = 8e-07 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +1 Query: 445 LQRRDWENPGVTQLNRLAAHP 507 LQRRDWENPGVTQLNRLAAHP Sbjct: 19 LQRRDWENPGVTQLNRLAAHP 39 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 41 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 83 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 43 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 72 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHP 42 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 41 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 41 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 45 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHP 44 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 44 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 73 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHP 43 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 62 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 91 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHP 61 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 31 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 60 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/28 (67%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = +2 Query: 431 HWPSFYNVVTGKTLALPNLIAL-QHIPF 511 HWPSFYNVVTGKTL + L L H PF Sbjct: 5 HWPSFYNVVTGKTLGVTQLNRLAAHPPF 32 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 157 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 186 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 132 LAVVLQRRDWENPGVTQLNRLAAHP 156 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 46 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 75 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHP 45 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 41 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 58 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 87 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 33 LAVVLQRRDWENPGVTQLNRLAAHP 57 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 1215 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 1244 Score = 61.7 bits (143), Expect = 4e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 586 HSPFRLRNCWEGRSVRASSLLRQLAKG 506 HSPFRLRNCWEGRSVRASSLLRQLAKG Sbjct: 404 HSPFRLRNCWEGRSVRASSLLRQLAKG 430 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 1190 LAVVLQRRDWENPGVTQLNRLAAHP 1214 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 102 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 131 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 77 LAVVLQRRDWENPGVTQLNRLAAHP 101 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 56 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 85 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHP 55 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 41 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 59 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 88 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 61 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 90 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHP 60 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 65 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 94 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHP 64 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 46 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 75 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHP 45 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 41 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 42 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 71 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHP 41 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 56 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 85 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHP 55 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 44 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 73 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHP 43 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 72 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 101 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 47 LAVVLQRRDWENPGVTQLNRLAAHP 71 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 57 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 86 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHP 56 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 83 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 112 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHP 82 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 42 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 71 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHP 41 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 85 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 114 Score = 59.3 bits (137), Expect = 2e-09 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGE 584 PFASWRNSEEARTDRPSQQLRSLNGE Sbjct: 20 PFASWRNSEEARTDRPSQQLRSLNGE 45 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHP 84 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 45 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHP 44 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 86 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 115 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 61 LAVVLQRRDWENPGVTQLNRLAAHP 85 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 42 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 71 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHP 41 >SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 50 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 79 Score = 50.8 bits (116), Expect = 8e-07 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +1 Query: 445 LQRRDWENPGVTQLNRLAAHP 507 LQRRDWENPGVTQLNRLAAHP Sbjct: 29 LQRRDWENPGVTQLNRLAAHP 49 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 45 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHP 44 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 98 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 127 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 167 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 196 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 142 LAVVLQRRDWENPGVTQLNRLAAHP 166 >SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 45 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHP 44 >SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 41 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 66 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 95 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHP 65 >SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 47 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 76 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHP 46 >SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 45 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHP 44 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 68 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 97 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHP 67 >SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 43 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 72 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHP 42 >SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 83 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 112 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHP 82 >SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 45 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHP 44 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 87 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 116 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHP 86 >SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 67 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 96 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 42 LAVVLQRRDWENPGVTQLNRLAAHP 66 >SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 42 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 71 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHP 41 >SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 58 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 87 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 33 LAVVLQRRDWENPGVTQLNRLAAHP 57 >SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 59 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 88 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 71 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 100 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHP 70 >SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 51 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 80 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHP 50 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 80 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 109 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHP 79 >SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 81 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 110 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHP 80 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 181 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 210 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 156 LAVVLQRRDWENPGVTQLNRLAAHP 180 >SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) Length = 82 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 52 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 81 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 27 LAVVLQRRDWENPGVTQLNRLAAHP 51 >SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 507 PFASWRNSEEARTDRPSQQLRSLNGEWQIV 596 PFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 83 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 112 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 LAVVLQRRDWENPGVTQLNRLAAHP 507 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHP 82 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,113,943 Number of Sequences: 59808 Number of extensions: 482668 Number of successful extensions: 8313 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5089 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8252 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1451595000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -