BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0192 (600 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 25 1.4 AY146723-1|AAO12083.1| 155|Anopheles gambiae odorant-binding pr... 24 3.3 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 7.5 AY745218-1|AAU93485.1| 159|Anopheles gambiae cytochrome P450 pr... 23 7.5 AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CY... 23 7.5 AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin bi... 23 7.5 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 23 10.0 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 25.4 bits (53), Expect = 1.4 Identities = 11/37 (29%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = +1 Query: 112 SWSLLFLFVESEERHV--GYFYHLKTNSGNVTDGVTF 216 S+ + F + +++ +V G+F+HL+ N G + TF Sbjct: 901 SYRMYFSQIAADDHYVPSGFFFHLRKNMGGLKRFSTF 937 >AY146723-1|AAO12083.1| 155|Anopheles gambiae odorant-binding protein AgamOBP17 protein. Length = 155 Score = 24.2 bits (50), Expect = 3.3 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = -3 Query: 595 TICHSPFRLRNCWEGRSVRASSLLRQL 515 T+C F L CW+ + + LR++ Sbjct: 121 TLCDKAFWLHKCWKQSDPKVNMALRRI 147 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.0 bits (47), Expect = 7.5 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +1 Query: 499 AHPLSPAGVIAKRPAPIAL 555 A P SPAGV+ + P+A+ Sbjct: 1338 AAPSSPAGVLVAKVPPVAV 1356 >AY745218-1|AAU93485.1| 159|Anopheles gambiae cytochrome P450 protein. Length = 159 Score = 23.0 bits (47), Expect = 7.5 Identities = 9/22 (40%), Positives = 13/22 (59%), Gaps = 2/22 (9%) Frame = -2 Query: 533 FAITP--AGERGCAARRLSWVT 474 FA+ P AG R C R +W++ Sbjct: 127 FALLPFSAGSRNCVGLRYAWIS 148 >AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CYP6S2 protein. Length = 504 Score = 23.0 bits (47), Expect = 7.5 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -2 Query: 338 RKCVRVQLIKNGKKVT 291 RKCVR L K+G ++T Sbjct: 330 RKCVRSTLAKHGNEMT 345 >AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin binding protein protein. Length = 567 Score = 23.0 bits (47), Expect = 7.5 Identities = 15/60 (25%), Positives = 24/60 (40%) Frame = -3 Query: 493 GD*VG*RQGFPSHDVVKRRPVNCNTTHYRANWVPGPPSRKLV*KLSSPTLPSANASVYSS 314 GD +G + + + KRR +N T +P L +P +PS A + S Sbjct: 10 GDELGLAESLGNVEANKRRALNIRTGANNIGVLPASKMPTSYPSLPAPIVPSPGAPIQQS 69 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 22.6 bits (46), Expect = 10.0 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +2 Query: 224 NPATSTSSFS*CGLGN 271 NPATS+ ++S LGN Sbjct: 593 NPATSSDAYSLIALGN 608 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 695,912 Number of Sequences: 2352 Number of extensions: 15235 Number of successful extensions: 27 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58029966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -