BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0191 (735 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U49974-1|AAC52011.1| 351|Homo sapiens mariner transposase protein. 35 0.35 >U49974-1|AAC52011.1| 351|Homo sapiens mariner transposase protein. Length = 351 Score = 34.7 bits (76), Expect = 0.35 Identities = 23/75 (30%), Positives = 33/75 (44%), Gaps = 3/75 (4%) Frame = -2 Query: 656 HPRTAPT*ALMISILSLKIKNNLRGQRFSSPEEAVDAYKTAIY---PNFRMECCFNDWFH 486 HP +P A L +K +L+G FSS T + P F + N W+H Sbjct: 278 HPPYSPDLAPSDFFLFPNLKKSLKGTHFSSVNNVKKTALTWLNSQDPQFFRDG-LNGWYH 336 Query: 485 RMEKCVNFRGEDFEK 441 R++KC+ G EK Sbjct: 337 RLQKCLELDGAYVEK 351 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 111,083,958 Number of Sequences: 237096 Number of extensions: 2278754 Number of successful extensions: 4507 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4360 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4505 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8735159784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -