BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0191 (735 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF098501-8|AAC67403.1| 459|Caenorhabditis elegans Hypothetical ... 60 1e-09 X01005-1|CAA25498.1| 273|Caenorhabditis elegans protein ( Caeno... 39 0.003 U39743-1|AAA80436.2| 314|Caenorhabditis elegans Hypothetical pr... 39 0.003 U29097-9|AAA68416.2| 343|Caenorhabditis elegans Hypothetical pr... 39 0.003 AF125450-4|AAD12818.1| 343|Caenorhabditis elegans Hypothetical ... 39 0.003 AF067947-2|AAC19229.2| 273|Caenorhabditis elegans Hypothetical ... 39 0.003 AF067947-1|AAC19233.1| 273|Caenorhabditis elegans Hypothetical ... 39 0.003 AF016682-7|AAB66191.2| 343|Caenorhabditis elegans Hypothetical ... 39 0.003 U49941-9|AAB53871.1| 141|Caenorhabditis elegans Hypothetical pr... 33 0.28 U23174-5|AAC46711.1| 329|Caenorhabditis elegans Hypothetical pr... 33 0.28 AF106576-3|AAK68401.1| 329|Caenorhabditis elegans Hypothetical ... 33 0.28 AC006671-2|AAO21381.1| 459|Caenorhabditis elegans Nuclear hormo... 33 0.28 AC006747-1|AAF60509.1| 311|Caenorhabditis elegans Hypothetical ... 29 4.5 Z69664-11|CAA93518.2| 1479|Caenorhabditis elegans Hypothetical p... 28 7.9 AL022716-7|CAA18775.2| 1479|Caenorhabditis elegans Hypothetical ... 28 7.9 AL021570-1|CAA16510.2| 1479|Caenorhabditis elegans Hypothetical ... 28 7.9 AF022983-4|AAB69944.1| 387|Caenorhabditis elegans Hypothetical ... 28 7.9 >AF098501-8|AAC67403.1| 459|Caenorhabditis elegans Hypothetical protein H28G03.4 protein. Length = 459 Score = 60.5 bits (140), Expect = 1e-09 Identities = 23/40 (57%), Positives = 30/40 (75%) Frame = -1 Query: 372 STQSWLETNVSDFIRAEDWPSSSPDLNPLDYYLWSVLESR 253 + Q+W E+N DFI WP SSPDLNP+DY +WSVLE++ Sbjct: 319 NVQAWCESNFPDFIAFNQWPPSSPDLNPMDYSVWSVLEAK 358 >X01005-1|CAA25498.1| 273|Caenorhabditis elegans protein ( Caenorhabditis eleganstransposable element Tc1. ). Length = 273 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = -1 Query: 321 DWPSSSPDLNPLDYYLWSVLESRL 250 DWPS SPDLNP++ +LW LE RL Sbjct: 200 DWPSQSPDLNPIE-HLWEELERRL 222 >U39743-1|AAA80436.2| 314|Caenorhabditis elegans Hypothetical protein R173.2 protein. Length = 314 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = -1 Query: 321 DWPSSSPDLNPLDYYLWSVLESRL 250 DWPS SPDLNP++ +LW LE RL Sbjct: 241 DWPSQSPDLNPIE-HLWEELERRL 263 >U29097-9|AAA68416.2| 343|Caenorhabditis elegans Hypothetical protein F18C5.7 protein. Length = 343 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = -1 Query: 321 DWPSSSPDLNPLDYYLWSVLESRL 250 DWPS SPDLNP++ +LW LE RL Sbjct: 270 DWPSQSPDLNPIE-HLWEELERRL 292 >AF125450-4|AAD12818.1| 343|Caenorhabditis elegans Hypothetical protein Y39F10A.4 protein. Length = 343 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = -1 Query: 321 DWPSSSPDLNPLDYYLWSVLESRL 250 DWPS SPDLNP++ +LW LE RL Sbjct: 270 DWPSQSPDLNPIE-HLWEKLERRL 292 >AF067947-2|AAC19229.2| 273|Caenorhabditis elegans Hypothetical protein T10B5.9 protein. Length = 273 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = -1 Query: 321 DWPSSSPDLNPLDYYLWSVLESRL 250 DWPS SPDLNP++ +LW LE RL Sbjct: 200 DWPSQSPDLNPIE-HLWEELERRL 222 >AF067947-1|AAC19233.1| 273|Caenorhabditis elegans Hypothetical protein T10B5.1 protein. Length = 273 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = -1 Query: 321 DWPSSSPDLNPLDYYLWSVLESRL 250 DWPS SPDLNP++ +LW LE RL Sbjct: 200 DWPSQSPDLNPIE-HLWEELERRL 222 >AF016682-7|AAB66191.2| 343|Caenorhabditis elegans Hypothetical protein T07D3.8 protein. Length = 343 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = -1 Query: 321 DWPSSSPDLNPLDYYLWSVLESRL 250 DWPS SPDLNP++ +LW LE RL Sbjct: 270 DWPSQSPDLNPIE-HLWEELERRL 292 >U49941-9|AAB53871.1| 141|Caenorhabditis elegans Hypothetical protein K10B3.2 protein. Length = 141 Score = 32.7 bits (71), Expect = 0.28 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = -1 Query: 321 DWPSSSPDLNPLDYYLWSVL 262 DWP+ SPDLNP++ LW +L Sbjct: 66 DWPARSPDLNPIE-NLWGIL 84 >U23174-5|AAC46711.1| 329|Caenorhabditis elegans Hypothetical protein R10H1.3 protein. Length = 329 Score = 32.7 bits (71), Expect = 0.28 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = -1 Query: 321 DWPSSSPDLNPLDYYLWSVL 262 DWP+ SPDLNP++ LW +L Sbjct: 254 DWPARSPDLNPIE-NLWGIL 272 >AF106576-3|AAK68401.1| 329|Caenorhabditis elegans Hypothetical protein W07E6.6 protein. Length = 329 Score = 32.7 bits (71), Expect = 0.28 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = -1 Query: 321 DWPSSSPDLNPLDYYLWSVL 262 DWP+ SPDLNP++ LW +L Sbjct: 254 DWPARSPDLNPIE-NLWGIL 272 >AC006671-2|AAO21381.1| 459|Caenorhabditis elegans Nuclear hormone receptor familyprotein 88, isoform b protein. Length = 459 Score = 32.7 bits (71), Expect = 0.28 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = -1 Query: 321 DWPSSSPDLNPLDYYLWSVL 262 DWP+ SPDLNP++ LW +L Sbjct: 384 DWPARSPDLNPIE-NLWGIL 402 >AC006747-1|AAF60509.1| 311|Caenorhabditis elegans Hypothetical protein Y39A3A.1 protein. Length = 311 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -1 Query: 315 PSSSPDLNPLDYYLWSVLESRLA 247 P SPDL P DY+L+ L++ LA Sbjct: 239 PPYSPDLAPTDYHLFRSLQNHLA 261 >Z69664-11|CAA93518.2| 1479|Caenorhabditis elegans Hypothetical protein C24F3.5 protein. Length = 1479 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +3 Query: 174 LSMGKFFTSNRTDCYRDSKLSWRLEQAYSLKL 269 LSMG FF +N T CY +W L A +L L Sbjct: 969 LSMG-FFATNTTSCYLRFLSAWFLSYASTLPL 999 >AL022716-7|CAA18775.2| 1479|Caenorhabditis elegans Hypothetical protein C24F3.5 protein. Length = 1479 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +3 Query: 174 LSMGKFFTSNRTDCYRDSKLSWRLEQAYSLKL 269 LSMG FF +N T CY +W L A +L L Sbjct: 969 LSMG-FFATNTTSCYLRFLSAWFLSYASTLPL 999 >AL021570-1|CAA16510.2| 1479|Caenorhabditis elegans Hypothetical protein C24F3.5 protein. Length = 1479 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +3 Query: 174 LSMGKFFTSNRTDCYRDSKLSWRLEQAYSLKL 269 LSMG FF +N T CY +W L A +L L Sbjct: 969 LSMG-FFATNTTSCYLRFLSAWFLSYASTLPL 999 >AF022983-4|AAB69944.1| 387|Caenorhabditis elegans Hypothetical protein R13D11.4 protein. Length = 387 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = -2 Query: 491 FHRMEKCVNFRGEDFEKQ*IHF*IVMLCHFVNSRNFQCRLVHSL 360 FHR+ V+F+ +++K + CHF+ R CRL+H L Sbjct: 144 FHRIFFRVDFQYYEWQK-------LSNCHFLTPRALPCRLIHPL 180 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,861,752 Number of Sequences: 27780 Number of extensions: 387429 Number of successful extensions: 920 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 876 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 919 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1724918872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -