BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0189 (591 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 50 4e-08 AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. 42 2e-05 AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. 42 2e-05 AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. 42 2e-05 AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. 42 2e-05 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 27 0.044 AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. 26 1.0 AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. 26 1.0 AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. 26 1.0 AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. 26 1.0 AY390604-1|AAR27301.1| 241|Anopheles gambiae SP22D protein. 26 1.0 AY390603-1|AAR27300.1| 241|Anopheles gambiae SP22D protein. 26 1.0 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 26 1.0 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 26 1.0 AY146746-1|AAO12061.1| 333|Anopheles gambiae odorant-binding pr... 25 1.8 AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 pr... 23 7.4 AJ496389-1|CAD43035.1| 103|Anopheles gambiae mannosyl glycoprot... 23 9.8 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 9.8 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 50.4 bits (115), Expect = 4e-08 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = +1 Query: 67 MRECISVHVGQAGVQIGNACWE 132 MRECISVHVGQAGVQIGN CW+ Sbjct: 1 MRECISVHVGQAGVQIGNPCWD 22 Score = 37.9 bits (84), Expect = 2e-04 Identities = 21/45 (46%), Positives = 23/45 (51%) Frame = +2 Query: 122 PAGSFTAWSTASSLMARCPQTRPSGVETILSTLSSARPELASTYP 256 P T WS AS+ RCP+TR S ST SS R AST P Sbjct: 19 PCWDCTVWSMASNRTVRCPRTRRSEAVMTRSTPSSPRLAQASTCP 63 >AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 41.5 bits (93), Expect = 2e-05 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = +3 Query: 384 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFH 482 HYT G E+VD VLD +RK + C LQGF + H Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTH 33 >AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 41.5 bits (93), Expect = 2e-05 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = +3 Query: 384 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFH 482 HYT G E+VD VLD +RK + C LQGF + H Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTH 33 >AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 41.5 bits (93), Expect = 2e-05 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = +3 Query: 384 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFH 482 HYT G E+VD VLD +RK + C LQGF + H Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTH 33 >AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 41.5 bits (93), Expect = 2e-05 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = +3 Query: 384 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFH 482 HYT G E+VD VLD +RK + C LQGF + H Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTH 33 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 27.1 bits (57), Expect(2) = 0.044 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +2 Query: 173 CPQTRPSGVETILSTLSSARPELASTYPCCLR 268 C RPS ++ ++ S RP+LA+ C R Sbjct: 164 CGSARPSRIDVAFASPSICRPDLAANSATCWR 195 Score = 21.8 bits (44), Expect(2) = 0.044 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +2 Query: 116 VMPAGSFTAWSTASSLMARCPQTRPSGV 199 V+ AG F AW TA +T+P G+ Sbjct: 116 VLLAGDFNAWHTAWG----SERTKPKGI 139 >AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 25.8 bits (54), Expect = 1.0 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -2 Query: 311 CASADLINNSRFKIDEDSTGTCLPAPVSLKKVLKESSPPPMVLS 180 CA L N + + D S +CLP P SL V + ++ P L+ Sbjct: 142 CAPGTLFNPNTRECDHPSKVSCLPVP-SLNSVNEPANRAPPKLA 184 >AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 25.8 bits (54), Expect = 1.0 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -2 Query: 311 CASADLINNSRFKIDEDSTGTCLPAPVSLKKVLKESSPPPMVLS 180 CA L N + + D S +CLP P SL V + ++ P L+ Sbjct: 142 CAPGTLFNPNTRECDHPSKVSCLPVP-SLNSVNEPANRAPPKLA 184 >AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 25.8 bits (54), Expect = 1.0 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -2 Query: 311 CASADLINNSRFKIDEDSTGTCLPAPVSLKKVLKESSPPPMVLS 180 CA L N + + D S +CLP P SL V + ++ P L+ Sbjct: 141 CAPGTLFNPNTRECDHPSKVSCLPVP-SLNSVNEPANRAPPKLA 183 >AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 25.8 bits (54), Expect = 1.0 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -2 Query: 311 CASADLINNSRFKIDEDSTGTCLPAPVSLKKVLKESSPPPMVLS 180 CA L N + + D S +CLP P SL V + ++ P L+ Sbjct: 141 CAPGTLFNPNTRECDHPSKVSCLPVP-SLNSVNEPANRAPPKLA 183 >AY390604-1|AAR27301.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 25.8 bits (54), Expect = 1.0 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -2 Query: 311 CASADLINNSRFKIDEDSTGTCLPAPVSLKKVLKESSPPPMVLS 180 CA L N + + D S +CLP P SL V + ++ P L+ Sbjct: 141 CAPGTLFNPNTRECDHPSKVSCLPVP-SLNSVNEPANRAPPKLA 183 >AY390603-1|AAR27300.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 25.8 bits (54), Expect = 1.0 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -2 Query: 311 CASADLINNSRFKIDEDSTGTCLPAPVSLKKVLKESSPPPMVLS 180 CA L N + + D S +CLP P SL V + ++ P L+ Sbjct: 141 CAPGTLFNPNTRECDHPSKVSCLPVP-SLNSVNEPANRAPPKLA 183 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 25.8 bits (54), Expect = 1.0 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -2 Query: 311 CASADLINNSRFKIDEDSTGTCLPAPVSLKKVLKESSPPPMVLS 180 CA L N + + D S +CLP P SL V + ++ P L+ Sbjct: 213 CAPGTLFNPNTRECDHPSKVSCLPVP-SLNSVNEPANRAPPKLA 255 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 25.8 bits (54), Expect = 1.0 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -2 Query: 311 CASADLINNSRFKIDEDSTGTCLPAPVSLKKVLKESSPPPMVLS 180 CA L N + + D S +CLP P SL V + ++ P L+ Sbjct: 212 CAPGTLFNPNTRECDHPSKVSCLPVP-SLNSVNEPANRAPPKLA 254 >AY146746-1|AAO12061.1| 333|Anopheles gambiae odorant-binding protein AgamOBP43 protein. Length = 333 Score = 25.0 bits (52), Expect = 1.8 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 231 DRSWQARTRAVFVDLEPTVVD 293 D+ +Q RTR+ LEP+V D Sbjct: 111 DQDYQNRTRSCLAALEPSVTD 131 >AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 23.0 bits (47), Expect = 7.4 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +3 Query: 195 GWRRFFQHFLQRDRSWQAR 251 GW + HF QR R W R Sbjct: 12 GWLWIYLHFNQRYRFWVER 30 >AJ496389-1|CAD43035.1| 103|Anopheles gambiae mannosyl glycoprotein transferase protein. Length = 103 Score = 22.6 bits (46), Expect = 9.8 Identities = 8/30 (26%), Positives = 15/30 (50%) Frame = +2 Query: 308 HIQTVVSSRTTYYW*GRCGQQLCPWSLHHW 397 H + +RT +Y RC + C + ++W Sbjct: 66 HNMGMAFNRTMWYEIVRCARHFCEYDDYNW 95 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 22.6 bits (46), Expect = 9.8 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +3 Query: 96 PSRSPDR*CLLGALLPGARHPA*WPDAHRQDHR 194 P+ P + L+ +LP + PA P R+D R Sbjct: 1107 PAVEPAKKTLVATILPNSAKPAQQPPPLRRDAR 1139 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 651,743 Number of Sequences: 2352 Number of extensions: 13460 Number of successful extensions: 35 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 56768445 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -