BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0188 (514 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g49160.1 68418.m06085 DNA (cytosine-5-)-methyltransferase (AT... 27 5.6 At1g66940.1 68414.m07608 protein kinase-related 27 7.4 >At5g49160.1 68418.m06085 DNA (cytosine-5-)-methyltransferase (ATHIM) identical to SP|P34881 DNA (cytosine-5)-methyltransferase AthI (EC 2.1.1.37) {Arabidopsis thaliana} Length = 1534 Score = 27.5 bits (58), Expect = 5.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +3 Query: 210 SIYKNDRCLEREKITNLNTSKFGRFFHTRICGFKN 314 +I +D C ++EK + + FGR H I G+++ Sbjct: 114 AILPSDVCTDKEKEKGVRCTSFGRVEHWSISGYED 148 >At1g66940.1 68414.m07608 protein kinase-related Length = 332 Score = 27.1 bits (57), Expect = 7.4 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -2 Query: 369 LLIIFISKVVSLTYICLCC 313 L++I +VSL ++CLCC Sbjct: 279 LILIVSGIIVSLVFLCLCC 297 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,077,110 Number of Sequences: 28952 Number of extensions: 179732 Number of successful extensions: 332 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 325 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 332 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 927799552 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -