BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0185 (669 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 23 1.7 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 23 1.7 DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory pro... 22 4.0 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 21 9.1 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 21 9.1 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 21 9.1 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 21 9.1 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 21 9.1 AF264695-1|AAG13009.1| 100|Tribolium castaneum cephalothorax pr... 21 9.1 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 21 9.1 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 23.4 bits (48), Expect = 1.7 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = +1 Query: 328 LNSINTSSVDRLVPLNVILEDYIKCSNNRIIDASCKDTG 444 + S+ + V L P + ++ S++RI+D CK G Sbjct: 4 MQSVEGAMVHHLEPHRMQIKPQSPSSSSRILDIPCKVCG 42 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 23.4 bits (48), Expect = 1.7 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = +1 Query: 328 LNSINTSSVDRLVPLNVILEDYIKCSNNRIIDASCKDTG 444 + S+ + V L P + ++ S++RI+D CK G Sbjct: 4 MQSVEGAMVHHLEPHRMQIKPQSPSSSSRILDIPCKVCG 42 >DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory protein 7 protein. Length = 127 Score = 22.2 bits (45), Expect = 4.0 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = +1 Query: 331 NSINTSSVDRLVPLNVILEDYIKCSNNRIIDASCKDTGR 447 N + VD+++ + +L +YIKC + + C GR Sbjct: 25 NKYDNVDVDKILNNDRVLTNYIKCLMD---EGPCTSEGR 60 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 9.1 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +2 Query: 20 LCLDEELQAEWVQYLEMKRGKIQKLDNYNSSRY 118 LCL E W Q MK K K+ + N Y Sbjct: 257 LCLTERQIKIWFQNRRMKWKKEHKMASMNIVPY 289 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 9.1 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +2 Query: 20 LCLDEELQAEWVQYLEMKRGKIQKLDNYNSSRY 118 LCL E W Q MK K K+ + N Y Sbjct: 257 LCLTERQIKIWFQNRRMKWKKEHKMASMNIVPY 289 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 9.1 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +2 Query: 20 LCLDEELQAEWVQYLEMKRGKIQKLDNYNSSRY 118 LCL E W Q MK K K+ + N Y Sbjct: 257 LCLTERQIKIWFQNRRMKWKKEHKMASMNIVPY 289 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.0 bits (42), Expect = 9.1 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +2 Query: 20 LCLDEELQAEWVQYLEMKRGKIQKLDNYNSSRY 118 LCL E W Q MK K K+ + N Y Sbjct: 213 LCLTERQIKIWFQNRRMKWKKEHKMASMNIVPY 245 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.0 bits (42), Expect = 9.1 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +2 Query: 20 LCLDEELQAEWVQYLEMKRGKIQKLDNYNSSRY 118 LCL E W Q MK K K+ + N Y Sbjct: 257 LCLTERQIKIWFQNRRMKWKKEHKMASMNIVPY 289 >AF264695-1|AAG13009.1| 100|Tribolium castaneum cephalothorax protein. Length = 100 Score = 21.0 bits (42), Expect = 9.1 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +2 Query: 20 LCLDEELQAEWVQYLEMKRGKIQKLDNYNSSRY 118 LCL E W Q MK K K+ + N Y Sbjct: 45 LCLTERQIKIWFQNRRMKWKKEHKMASMNIVPY 77 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.0 bits (42), Expect = 9.1 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +2 Query: 20 LCLDEELQAEWVQYLEMKRGKIQKLDNYNSSRY 118 LCL E W Q MK K K+ + N Y Sbjct: 257 LCLTERQIKIWFQNRRMKWKKEHKMASMNIVPY 289 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,903 Number of Sequences: 336 Number of extensions: 2608 Number of successful extensions: 11 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17385535 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -