BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0185 (669 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein ... 23 3.5 AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein ... 23 3.5 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 21 8.0 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 21 8.0 >DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein 6 protein. Length = 125 Score = 22.6 bits (46), Expect = 3.5 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +1 Query: 352 VDRLVPLNVILEDYIKCSNNRIIDASCKDTGR 447 +DR++ IL +YIKC + + C + GR Sbjct: 30 IDRILQNGRILTNYIKC---MLDEGPCTNEGR 58 >AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein protein. Length = 125 Score = 22.6 bits (46), Expect = 3.5 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +1 Query: 352 VDRLVPLNVILEDYIKCSNNRIIDASCKDTGR 447 +DR++ IL +YIKC + + C + GR Sbjct: 30 IDRILQNGRILTNYIKC---MLDEGPCTNEGR 58 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.4 bits (43), Expect = 8.0 Identities = 10/41 (24%), Positives = 20/41 (48%) Frame = -3 Query: 640 EFRENP*RNRLSYRIECKAQCSS*SPSLVTKFESGSLTSLK 518 E E P L +R EC+ + + P + + E+ + ++K Sbjct: 48 EIIEQPASKALRFRYECEGRSAGSIPGVNSTSENKTFPTIK 88 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 21.4 bits (43), Expect = 8.0 Identities = 10/41 (24%), Positives = 20/41 (48%) Frame = -3 Query: 640 EFRENP*RNRLSYRIECKAQCSS*SPSLVTKFESGSLTSLK 518 E E P L +R EC+ + + P + + E+ + ++K Sbjct: 48 EIIEQPASKALRFRYECEGRSAGSIPGVNSTSENKTFPTIK 88 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,534 Number of Sequences: 438 Number of extensions: 3084 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20221290 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -