BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0183 (684 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11586| Best HMM Match : CLN3 (HMM E-Value=8.3e-10) 30 1.5 SB_52148| Best HMM Match : EGF (HMM E-Value=0) 29 3.5 SB_51675| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_7259| Best HMM Match : ResIII (HMM E-Value=0.21) 28 8.1 SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) 28 8.1 SB_43919| Best HMM Match : Ribosomal_S30 (HMM E-Value=5) 28 8.1 >SB_11586| Best HMM Match : CLN3 (HMM E-Value=8.3e-10) Length = 507 Score = 30.3 bits (65), Expect = 1.5 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -3 Query: 556 VKSLGYCFTRFLAGWN 509 V+ GYCFTR L GWN Sbjct: 482 VEDTGYCFTRSLHGWN 497 >SB_52148| Best HMM Match : EGF (HMM E-Value=0) Length = 1055 Score = 29.1 bits (62), Expect = 3.5 Identities = 18/58 (31%), Positives = 26/58 (44%) Frame = +2 Query: 83 CSCENVHGALEKREMSGFVCVLMLAGVASAQITLDGIRCGQLICQLDEYCSPETNRCV 256 C C H +K ++ VC + +TLDG RC + Q + C E+N CV Sbjct: 691 CKCGQRHCG-DKSNLTNNVCQFSHCIHGNCMVTLDGHRCARCSEQAMDPC--ESNPCV 745 >SB_51675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 689 Score = 28.3 bits (60), Expect = 6.1 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = +1 Query: 70 QCLCLFLRKCTRCFREERDVGIRVCPDARWRRLRSNHPGRHQMRSA 207 Q L + K C+ E + CP +W+++ N PG HQ A Sbjct: 516 QSLLTRIEKSRTCW--EAGIDYHWCPCLKWKQVSVNTPGIHQSAEA 559 >SB_7259| Best HMM Match : ResIII (HMM E-Value=0.21) Length = 956 Score = 27.9 bits (59), Expect = 8.1 Identities = 26/107 (24%), Positives = 41/107 (38%), Gaps = 2/107 (1%) Frame = +1 Query: 88 LRKCTRC-FREERDVGIRVCP-DARWRRLRSNHPGRHQMRSADMSARRILLPGDQPMRPC 261 LR CT + + G+++ + R+ R PG A +R P P PC Sbjct: 489 LRVCTDAIYAKAVPSGVKLVERNPRYGEWRHKKPGYEWRPEAAWGPKR--KPSTAPSLPC 546 Query: 262 NVVCNKTHHNYDSGLCVKECQGYLLDLRYMRRSETAPPPNDLGSIHR 402 ++V + Y +G G+ + + R P NDL HR Sbjct: 547 DLVAATSAKMYLAGQGGSGKTGWAVSMFRGRNVVVLTPENDLAHDHR 593 >SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) Length = 5087 Score = 27.9 bits (59), Expect = 8.1 Identities = 18/60 (30%), Positives = 26/60 (43%) Frame = +3 Query: 492 EIFKAKFQPAKNRVKQYPNDLTHHNPHAETPKPKPELKLEIRNPDPLRRTNQPFNVKDLK 671 E FK + QP V + E P+PK E+K+E P R QP +++K Sbjct: 611 EEFKIE-QPQPKEVVKIEQPQPEEEVRIEQPQPKEEVKIEQPQPKEEVRIEQPQPEEEVK 669 >SB_43919| Best HMM Match : Ribosomal_S30 (HMM E-Value=5) Length = 217 Score = 27.9 bits (59), Expect = 8.1 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Frame = +3 Query: 501 KAKFQPAKN-RVKQYPNDLTHHNPHAETPKPKPELKLEIRNPDPLRRTNQPFNV 659 K K +P K +K Y HHN +P P+ KL + ++ TN PF + Sbjct: 86 KTKKKPTKGCALKNYYR--CHHNTRNWSPSKDPQKKLLLNPSARVKNTNCPFQM 137 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,816,954 Number of Sequences: 59808 Number of extensions: 469563 Number of successful extensions: 1259 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1145 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1253 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1769412099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -