BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0183 (684 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ004400-1|AAY21239.1| 144|Anopheles gambiae lysozyme c-5 protein. 23 9.0 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 9.0 >DQ004400-1|AAY21239.1| 144|Anopheles gambiae lysozyme c-5 protein. Length = 144 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = -3 Query: 412 FELHGVCFPNRWVAGPSPNVACTSNPIDNL 323 F+L N W+AG ++ C+S D++ Sbjct: 73 FQLQSAYHCNEWIAGNECHLKCSSLVNDDI 102 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = +2 Query: 143 VLMLAGVASAQITLDGIRCGQLICQLDEYCSPET 244 V M A A+A + I + DEY P+T Sbjct: 1129 VAMAAAAAAAAAGASNVDVPSTIAETDEYLQPKT 1162 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 721,338 Number of Sequences: 2352 Number of extensions: 14690 Number of successful extensions: 33 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -