BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0182 (632 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30514| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=1.2) 29 4.1 SB_33808| Best HMM Match : Fibrinogen_C (HMM E-Value=0) 27 9.6 >SB_30514| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=1.2) Length = 249 Score = 28.7 bits (61), Expect = 4.1 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -3 Query: 303 HTNARGGPVVQETHPGKSTYRSPQIIGIYTYAQ 205 H + GGP + + H G TY + + IYT A+ Sbjct: 63 HGGSSGGPTILDLHSGALTY-GEKFVNIYTLAK 94 >SB_33808| Best HMM Match : Fibrinogen_C (HMM E-Value=0) Length = 280 Score = 27.5 bits (58), Expect = 9.6 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = -2 Query: 64 FQSGFGSLISNFYLIISNLH 5 +++GFGSL S F+L + N+H Sbjct: 56 YETGFGSLSSEFWLGLINIH 75 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,360,987 Number of Sequences: 59808 Number of extensions: 384946 Number of successful extensions: 756 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 696 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 756 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1584657875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -