BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0178 (677 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor... 25 2.9 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 6.7 >DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor 22 protein. Length = 467 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = +1 Query: 553 PFASWRNSEEARTDRPSQQVAQPEWRMANCKPLIF 657 P ASWRN E + Q ++ + KP++F Sbjct: 162 PVASWRNGSEVAKFKNMWTDFQYKYLIVTGKPIVF 196 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +1 Query: 511 NPGVTQLNRLAAHPPFASWRNS 576 +PG +L+ HPP AS R+S Sbjct: 835 HPGAQTQPQLSQHPPGASGRSS 856 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 734,445 Number of Sequences: 2352 Number of extensions: 16336 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68159265 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -