BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0177 (656 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF254088-1|AAG09037.1| 609|Homo sapiens EWS/ZSG fusion protein ... 31 3.6 AF254087-1|AAG09036.1| 713|Homo sapiens EWS/ZSG fusion protein ... 31 3.6 AF254086-1|AAG09035.1| 609|Homo sapiens EWS/ZSG fusion protein ... 31 3.6 BC037170-1|AAH37170.1| 413|Homo sapiens protease, serine, 35 pr... 30 6.3 AY358661-1|AAQ89024.1| 413|Homo sapiens ENML522 protein. 30 6.3 >AF254088-1|AAG09037.1| 609|Homo sapiens EWS/ZSG fusion protein long B isoform protein. Length = 609 Score = 31.1 bits (67), Expect = 3.6 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = -1 Query: 611 DRGRRSRPKERSGRDGIGSETGRPPSCWRRGRER 510 DRG SR GR G+G + PP +RGR R Sbjct: 308 DRGGMSRGGRGGGRGGMGVASSAPPLTGKRGRGR 341 >AF254087-1|AAG09036.1| 713|Homo sapiens EWS/ZSG fusion protein long A isoform protein. Length = 713 Score = 31.1 bits (67), Expect = 3.6 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = -1 Query: 611 DRGRRSRPKERSGRDGIGSETGRPPSCWRRGRER 510 DRG SR GR G+G + PP +RGR R Sbjct: 308 DRGGMSRGGRGGGRGGMGVASSAPPLTGKRGRGR 341 >AF254086-1|AAG09035.1| 609|Homo sapiens EWS/ZSG fusion protein short isoform protein. Length = 609 Score = 31.1 bits (67), Expect = 3.6 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = -1 Query: 611 DRGRRSRPKERSGRDGIGSETGRPPSCWRRGRER 510 DRG SR GR G+G + PP +RGR R Sbjct: 308 DRGGMSRGGRGGGRGGMGVASSAPPLTGKRGRGR 341 >BC037170-1|AAH37170.1| 413|Homo sapiens protease, serine, 35 protein. Length = 413 Score = 30.3 bits (65), Expect = 6.3 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -1 Query: 626 REHTQDRGRRSRPKERSGRDGIGSETGRPPSCWRR 522 REH Q+R + R +++SGR G GRP W R Sbjct: 220 REHLQERAKGGRRRKKSGR-GQRIAEGRPSFQWTR 253 >AY358661-1|AAQ89024.1| 413|Homo sapiens ENML522 protein. Length = 413 Score = 30.3 bits (65), Expect = 6.3 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -1 Query: 626 REHTQDRGRRSRPKERSGRDGIGSETGRPPSCWRR 522 REH Q+R + R +++SGR G GRP W R Sbjct: 220 REHLQERAKGGRRRKKSGR-GQRIAEGRPSFQWTR 253 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 56,262,131 Number of Sequences: 237096 Number of extensions: 806740 Number of successful extensions: 3087 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2916 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3087 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7366354010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -