BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0177 (656 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF125964-1|AAD14753.1| 471|Caenorhabditis elegans Hypothetical ... 29 2.2 AC006708-26|AAF60419.1| 1724|Caenorhabditis elegans Holocentric ... 28 5.1 AC006708-25|AAK68883.1| 1758|Caenorhabditis elegans Holocentric ... 28 5.1 >AF125964-1|AAD14753.1| 471|Caenorhabditis elegans Hypothetical protein W03G1.5 protein. Length = 471 Score = 29.5 bits (63), Expect = 2.2 Identities = 19/49 (38%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Frame = -1 Query: 623 EHTQDRGRRSRPKERSGRDGIGSETGRPPSCWRRGRE--RSGMSEHWST 483 E + D R + ERSG S + R PS RRG RSG S S+ Sbjct: 143 ESSDDENDRKKKGERSGSSSSSSGSSRSPSRGRRGGRGGRSGSSSSSSS 191 >AC006708-26|AAF60419.1| 1724|Caenorhabditis elegans Holocentric chromosome bindingprotein protein 6, isoform a protein. Length = 1724 Score = 28.3 bits (60), Expect = 5.1 Identities = 17/36 (47%), Positives = 21/36 (58%) Frame = +2 Query: 485 CSSARTCRYAPALAASKTVVSQSLTQSHPAQIAPLV 592 CSS +T RYAP LAAS S + + QIA L+ Sbjct: 1069 CSSYKTDRYAPMLAASLCDPSVIVRRHAINQIARLI 1104 >AC006708-25|AAK68883.1| 1758|Caenorhabditis elegans Holocentric chromosome bindingprotein protein 6, isoform b protein. Length = 1758 Score = 28.3 bits (60), Expect = 5.1 Identities = 17/36 (47%), Positives = 21/36 (58%) Frame = +2 Query: 485 CSSARTCRYAPALAASKTVVSQSLTQSHPAQIAPLV 592 CSS +T RYAP LAAS S + + QIA L+ Sbjct: 1069 CSSYKTDRYAPMLAASLCDPSVIVRRHAINQIARLI 1104 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,158,794 Number of Sequences: 27780 Number of extensions: 109356 Number of successful extensions: 419 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 408 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 417 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1465835342 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -