BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0177 (656 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g15820.1 68418.m01851 zinc finger (C3HC4-type RING finger) fa... 30 1.6 At1g55990.1 68414.m06423 glycine-rich protein predicted proteins... 29 2.7 At1g76850.1 68414.m08943 expressed protein 28 6.3 >At5g15820.1 68418.m01851 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 348 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/43 (44%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -2 Query: 640 SVGESVSIPKTVAGVADQRSDLG-GMGLGQRLGDHRLAGGEGG 515 S + VS P + DQ DLG G+GLG R G +L G GG Sbjct: 100 SSNQRVSTPGYF-NIWDQDVDLGLGIGLGSRSGSGQLPGDSGG 141 >At1g55990.1 68414.m06423 glycine-rich protein predicted proteins, Arabidopsis thaliana Length = 139 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -1 Query: 575 GRDGIGSETGRPPSCWRRGRE 513 G+DG G+ G CWRR RE Sbjct: 86 GKDGCGNVDGNGGCCWRRRRE 106 >At1g76850.1 68414.m08943 expressed protein Length = 1090 Score = 27.9 bits (59), Expect = 6.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -1 Query: 608 RGRRSRPKERSGRDGIGSETGRPPSCWRRGRE 513 RG R K R+ ++ G+ G P CW+R E Sbjct: 109 RGSDVREKGRARKEDDGAWDGGEPDCWKRVNE 140 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,062,395 Number of Sequences: 28952 Number of extensions: 112354 Number of successful extensions: 412 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 399 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 412 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1373722560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -