Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0175
         (638 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g35630.1 68417.m05060 phosphoserine aminotransferase, chlorop...    27   7.9  

>At4g35630.1 68417.m05060 phosphoserine aminotransferase,
           chloroplast (PSAT) identical to Phosphoserine
           aminotransferase, chloroplast precursor (PSAT)
           (SP:Q96255)[Arabidopsis thaliana]; contains TIGRFAM
           TIGR01364: phosphoserine aminotransferase; contains Pfam
           PF00266: aminotransferase, class V
          Length = 430

 Score = 27.5 bits (58), Expect = 7.9
 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 1/32 (3%)
 Frame = -2

Query: 631 EDGIYLGTVGSVSLFYK*LAGPAT-KRNVKLK 539
           +DG+  G+VGS    +   AGPAT   NV LK
Sbjct: 59  QDGVRSGSVGSQERVFNFAAGPATLPENVLLK 90


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,386,651
Number of Sequences: 28952
Number of extensions: 236546
Number of successful extensions: 334
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 330
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 334
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1314848736
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)