BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0174 (542 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g04980.1 68414.m00497 thioredoxin family protein similar to S... 97 5e-21 At2g32920.1 68415.m04036 thioredoxin family protein similar to S... 89 2e-18 At5g60640.2 68418.m07611 thioredoxin family protein similar to p... 75 4e-14 At5g60640.1 68418.m07610 thioredoxin family protein similar to p... 75 4e-14 At3g54960.1 68416.m06094 thioredoxin family protein similar to p... 74 7e-14 At2g47470.2 68415.m05924 thioredoxin family protein similar to p... 73 9e-14 At2g47470.1 68415.m05925 thioredoxin family protein similar to p... 73 9e-14 At1g21750.2 68414.m02723 protein disulfide isomerase, putative s... 68 4e-12 At1g21750.1 68414.m02722 protein disulfide isomerase, putative s... 68 4e-12 At1g77510.1 68414.m09026 protein disulfide isomerase, putative s... 59 2e-09 At1g43560.1 68414.m05000 thioredoxin family protein contains Pfa... 52 3e-07 At1g76760.1 68414.m08933 thioredoxin family protein similar to t... 51 4e-07 At1g35620.1 68414.m04425 thioredoxin family protein similar to S... 50 8e-07 At1g52260.1 68414.m05897 thioredoxin family protein similar to p... 49 2e-06 At1g07960.3 68414.m00867 thioredoxin family protein low similari... 48 4e-06 At1g07960.2 68414.m00866 thioredoxin family protein low similari... 48 4e-06 At1g07960.1 68414.m00865 thioredoxin family protein low similari... 48 4e-06 At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-... 46 2e-05 At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-... 43 1e-04 At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-... 43 1e-04 At3g16110.1 68416.m02035 thioredoxin family protein similar to p... 43 2e-04 At1g34780.1 68414.m04329 protein disulfide isomerase-related con... 39 0.002 At4g08930.1 68417.m01470 thioredoxin-related contains weak simil... 38 0.003 At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29... 38 0.003 At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29... 38 0.004 At1g50320.1 68414.m05641 thioredoxin x nearly identical to thior... 38 0.006 At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identica... 36 0.013 At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) i... 36 0.017 At4g27080.1 68417.m03893 thioredoxin family protein contains Pfa... 35 0.031 At1g52990.1 68414.m05997 thioredoxin family protein similar to S... 35 0.040 At4g26160.1 68417.m03765 thioredoxin family protein low similari... 34 0.053 At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-... 34 0.053 At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) i... 34 0.053 At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) i... 34 0.071 At3g20560.1 68416.m02603 thioredoxin family protein contains Pfa... 34 0.071 At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / P... 33 0.093 At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to te... 32 0.22 At2g41680.1 68415.m05149 thioredoxin reductase, putative / NADPH... 32 0.28 At4g12170.1 68417.m01934 thioredoxin family protein similar to S... 31 0.50 At1g08570.1 68414.m00950 thioredoxin family protein contains Pfa... 31 0.50 At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38... 31 0.66 At3g56420.1 68416.m06275 thioredoxin family protein similar to t... 30 1.1 At4g29670.2 68417.m04227 thioredoxin family protein contains Pfa... 29 1.5 At4g29670.1 68417.m04226 thioredoxin family protein contains Pfa... 29 1.5 At3g06730.1 68416.m00798 thioredoxin family protein contains Pfa... 29 1.5 At1g76810.1 68414.m08938 eukaryotic translation initiation facto... 29 1.5 At3g08710.1 68416.m01012 thioredoxin family protein similar to t... 29 2.0 At3g03860.1 68416.m00398 expressed protein 29 2.0 At4g21990.1 68417.m03183 5'-adenylylsulfate reductase (APR3) / P... 28 3.5 At1g15020.2 68414.m01795 thioredoxin family protein low similari... 28 3.5 At1g15020.1 68414.m01794 thioredoxin family protein low similari... 28 3.5 At2g33270.1 68415.m04078 thioredoxin family protein contains Pfa... 28 4.6 At2g01270.1 68415.m00040 thioredoxin family protein low similari... 28 4.6 At3g53220.1 68416.m05864 thioredoxin family protein low similari... 27 6.1 At2g32760.1 68415.m04008 expressed protein 27 6.1 At1g29790.1 68414.m03642 expressed protein 27 6.1 At1g27600.2 68414.m03368 glycosyl transferase family 43 protein ... 27 6.1 At5g11640.1 68418.m01361 expressed protein predicted proteins, D... 27 8.1 At4g30610.1 68417.m04342 serine carboxypeptidase S10 family prot... 27 8.1 At1g50950.1 68414.m05728 thioredoxin-related contains weak hit t... 27 8.1 At1g11490.1 68414.m01320 zinc finger (C2H2 type) family protein ... 27 8.1 >At1g04980.1 68414.m00497 thioredoxin family protein similar to SP|Q63081 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Rattus norvegicus}; contains Pfam profile PF00085: Thioredoxin Length = 443 Score = 97.5 bits (232), Expect = 5e-21 Identities = 46/91 (50%), Positives = 57/91 (62%), Gaps = 1/91 (1%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALKGIVKVGALDADEHRSVSQKYGVTGFPTIKIFT-GSKHTPY 431 WCGHC+SL P ++K A LKGI V A+DAD H+SVSQ YGV GFPTIK+F G Y Sbjct: 57 WCGHCQSLTPTWEKVASTLKGIATVAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDY 116 Query: 432 QGQRTAEGFVEAALNAAKEKAYENLGKKSSG 524 QG R A+ + A+ K + L K+SG Sbjct: 117 QGARDAKSISQFAIKQIKALLKDRLDGKTSG 147 Score = 81.4 bits (192), Expect = 4e-16 Identities = 37/82 (45%), Positives = 50/82 (60%), Gaps = 2/82 (2%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALKGIVKVGALDADEHRSVSQKYGVTGFPTIKIFTGSKHT--P 428 WCGHCK L PE+KKAA LKG VK+G ++ D +S+ ++ V GFPTI +F K + P Sbjct: 192 WCGHCKKLAPEWKKAANNLKGKVKLGHVNCDAEQSIKSRFKVQGFPTILVFGSDKSSPVP 251 Query: 429 YQGQRTAEGFVEAALNAAKEKA 494 Y+G R+A AL + A Sbjct: 252 YEGARSASAIESFALEQLESNA 273 Score = 49.2 bits (112), Expect = 2e-06 Identities = 22/40 (55%), Positives = 27/40 (67%) Frame = +1 Query: 178 IELTPSNFDKLLTNSDEIWIIEFFAPGVDIVKALFPNIKK 297 +EL SNFD+L+T S E+WI+EFFAP K L P KK Sbjct: 166 VELNSSNFDELVTESKELWIVEFFAPWCGHCKKLAPEWKK 205 Score = 48.8 bits (111), Expect = 2e-06 Identities = 23/50 (46%), Positives = 34/50 (68%) Frame = +1 Query: 151 ALYDSSSDVIELTPSNFDKLLTNSDEIWIIEFFAPGVDIVKALFPNIKKL 300 ALY SSS V++LTPSNF + NS+ + ++EFFAP ++L P +K+ Sbjct: 22 ALYGSSSPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQSLTPTWEKV 71 >At2g32920.1 68415.m04036 thioredoxin family protein similar to SP|Q15084 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Homo sapiens}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 89.0 bits (211), Expect = 2e-18 Identities = 41/89 (46%), Positives = 52/89 (58%), Gaps = 1/89 (1%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALKGIVKVGALDADEHRSVSQKYGVTGFPTIKIFT-GSKHTPY 431 WCGHCK+L P ++K A LKG+ V A+DAD H+S +Q YG+ GFPTIK+F G Y Sbjct: 59 WCGHCKALTPTWEKVANILKGVATVAAIDADAHQSAAQDYGIKGFPTIKVFVPGKAPIDY 118 Query: 432 QGQRTAEGFVEAALNAAKEKAYENLGKKS 518 QG R A+ A K + L KS Sbjct: 119 QGARDAKSIANFAYKQIKGLLSDRLEGKS 147 Score = 75.8 bits (178), Expect = 2e-14 Identities = 34/82 (41%), Positives = 50/82 (60%), Gaps = 2/82 (2%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALKGIVKVGALDADEHRSVSQKYGVTGFPTIKIFTGSKHT--P 428 WCGHCK L PE+K+AA+ L+G VK+G ++ D +S+ ++ V GFPTI +F K + P Sbjct: 191 WCGHCKKLAPEWKRAAKNLQGKVKLGHVNCDVEQSIMSRFKVQGFPTILVFGPDKSSPYP 250 Query: 429 YQGQRTAEGFVEAALNAAKEKA 494 Y+G R+A A + A Sbjct: 251 YEGARSASAIESFASELVESSA 272 Score = 50.0 bits (114), Expect = 1e-06 Identities = 25/55 (45%), Positives = 35/55 (63%) Frame = +1 Query: 145 SLALYDSSSDVIELTPSNFDKLLTNSDEIWIIEFFAPGVDIVKALFPNIKKLPEL 309 S ALY SSS V++LT SNF + NS+ + ++EFFAP KAL P +K+ + Sbjct: 22 SSALYGSSSPVVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVANI 76 Score = 46.4 bits (105), Expect = 1e-05 Identities = 23/52 (44%), Positives = 29/52 (55%) Frame = +1 Query: 142 GSLALYDSSSDVIELTPSNFDKLLTNSDEIWIIEFFAPGVDIVKALFPNIKK 297 GS S +EL SNFD L+ S+E+WI+EFFAP K L P K+ Sbjct: 153 GSKEKKSEPSASVELNASNFDDLVIESNELWIVEFFAPWCGHCKKLAPEWKR 204 >At5g60640.2 68418.m07611 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 536 Score = 74.5 bits (175), Expect = 4e-14 Identities = 35/71 (49%), Positives = 44/71 (61%), Gaps = 2/71 (2%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALK--GIVKVGALDADEHRSVSQKYGVTGFPTIKIFTGSKHTP 428 WCGHC+SL PEY AA LK G+V + +DA E ++Q+Y V GFPT+ F +H P Sbjct: 131 WCGHCQSLAPEYAAAATELKEDGVV-LAKIDATEENELAQEYRVQGFPTLLFFVDGEHKP 189 Query: 429 YQGQRTAEGFV 461 Y G RT E V Sbjct: 190 YTGGRTKETIV 200 Score = 45.6 bits (103), Expect = 2e-05 Identities = 22/61 (36%), Positives = 28/61 (45%) Frame = +3 Query: 243 VLCTWCGHCKSLVPEYKKAARALKGIVKVGALDADEHRSVSQKYGVTGFPTIKIFTGSKH 422 V WCGHC++L P Y K A+ L+ I + D + K GFPTI F Sbjct: 466 VYAPWCGHCQALEPMYNKLAKHLRSIDSLVITKMDGTTNEHPKAKAEGFPTILFFPAGNK 525 Query: 423 T 425 T Sbjct: 526 T 526 >At5g60640.1 68418.m07610 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 597 Score = 74.5 bits (175), Expect = 4e-14 Identities = 35/71 (49%), Positives = 44/71 (61%), Gaps = 2/71 (2%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALK--GIVKVGALDADEHRSVSQKYGVTGFPTIKIFTGSKHTP 428 WCGHC+SL PEY AA LK G+V + +DA E ++Q+Y V GFPT+ F +H P Sbjct: 131 WCGHCQSLAPEYAAAATELKEDGVV-LAKIDATEENELAQEYRVQGFPTLLFFVDGEHKP 189 Query: 429 YQGQRTAEGFV 461 Y G RT E V Sbjct: 190 YTGGRTKETIV 200 Score = 45.6 bits (103), Expect = 2e-05 Identities = 22/61 (36%), Positives = 28/61 (45%) Frame = +3 Query: 243 VLCTWCGHCKSLVPEYKKAARALKGIVKVGALDADEHRSVSQKYGVTGFPTIKIFTGSKH 422 V WCGHC++L P Y K A+ L+ I + D + K GFPTI F Sbjct: 466 VYAPWCGHCQALEPMYNKLAKHLRSIDSLVITKMDGTTNEHPKAKAEGFPTILFFPAGNK 525 Query: 423 T 425 T Sbjct: 526 T 526 >At3g54960.1 68416.m06094 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 579 Score = 73.7 bits (173), Expect = 7e-14 Identities = 31/70 (44%), Positives = 44/70 (62%), Gaps = 1/70 (1%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALKGIVKVGALDADEHRSVSQKYGVTGFPTIKIFT-GSKHTPY 431 WCG C++L PEY AA LKG+ + +DA E ++QKY + GFPT+ +F G Y Sbjct: 127 WCGACQALTPEYAAAATELKGLAALAKIDATEEGDLAQKYEIQGFPTVFLFVDGEMRKTY 186 Query: 432 QGQRTAEGFV 461 +G+RT +G V Sbjct: 187 EGERTKDGIV 196 Score = 46.4 bits (105), Expect = 1e-05 Identities = 21/57 (36%), Positives = 27/57 (47%) Frame = +3 Query: 243 VLCTWCGHCKSLVPEYKKAARALKGIVKVGALDADEHRSVSQKYGVTGFPTIKIFTG 413 + WCGHC+S P Y K + LKGI + D + + GFPTI F G Sbjct: 462 IYAPWCGHCQSFEPIYNKLGKYLKGIDSLVVAKMDGTSNEHPRAKADGFPTILFFPG 518 >At2g47470.2 68415.m05924 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 266 Score = 73.3 bits (172), Expect = 9e-14 Identities = 38/94 (40%), Positives = 55/94 (58%), Gaps = 5/94 (5%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALK---GIVKVGALDADEHRSVSQKYGVTGFPTIKIFTGSKHT 425 WCGHCKSL P Y+K A K G+V + LDAD H+++ +KYGV+GFPT+K F Sbjct: 170 WCGHCKSLAPTYEKVATVFKQEEGVV-IANLDADAHKALGEKYGVSGFPTLKFFPKDNKA 228 Query: 426 --PYQGQRTAEGFVEAALNAAKEKAYENLGKKSS 521 Y G R + FV + +N + ++ G+ +S Sbjct: 229 GHDYDGGRDLDDFV-SFINEKSGTSRDSKGQLTS 261 Score = 71.3 bits (167), Expect = 4e-13 Identities = 34/74 (45%), Positives = 43/74 (58%), Gaps = 4/74 (5%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALKGI--VKVGALDADEHRSVSQKYGVTGFPTIKIFTGSKHTP 428 WCGHCK L PEY+K + K V + +D DE +SV KYGV+G+PTI+ F P Sbjct: 51 WCGHCKKLAPEYEKLGASFKKAKSVLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEP 110 Query: 429 --YQGQRTAEGFVE 464 Y+G R AE E Sbjct: 111 QKYEGPRNAEALAE 124 Score = 37.5 bits (83), Expect = 0.006 Identities = 15/43 (34%), Positives = 29/43 (67%) Frame = +1 Query: 172 DVIELTPSNFDKLLTNSDEIWIIEFFAPGVDIVKALFPNIKKL 300 +V+ LTP NFD+++ + ++ ++EF+AP K+L P +K+ Sbjct: 142 NVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKV 184 Score = 30.3 bits (65), Expect = 0.87 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = +1 Query: 166 SSDVIELTPSNFDKLLTNSDEIWIIEFFAPGVDIVKALFPNIKKL 300 + DV+ LT +F+K + D+ ++EF+AP K L P +KL Sbjct: 22 ADDVVVLTDDSFEKEV-GKDKGALVEFYAPWCGHCKKLAPEYEKL 65 >At2g47470.1 68415.m05925 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 361 Score = 73.3 bits (172), Expect = 9e-14 Identities = 38/94 (40%), Positives = 55/94 (58%), Gaps = 5/94 (5%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALK---GIVKVGALDADEHRSVSQKYGVTGFPTIKIFTGSKHT 425 WCGHCKSL P Y+K A K G+V + LDAD H+++ +KYGV+GFPT+K F Sbjct: 170 WCGHCKSLAPTYEKVATVFKQEEGVV-IANLDADAHKALGEKYGVSGFPTLKFFPKDNKA 228 Query: 426 --PYQGQRTAEGFVEAALNAAKEKAYENLGKKSS 521 Y G R + FV + +N + ++ G+ +S Sbjct: 229 GHDYDGGRDLDDFV-SFINEKSGTSRDSKGQLTS 261 Score = 71.3 bits (167), Expect = 4e-13 Identities = 34/74 (45%), Positives = 43/74 (58%), Gaps = 4/74 (5%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALKGI--VKVGALDADEHRSVSQKYGVTGFPTIKIFTGSKHTP 428 WCGHCK L PEY+K + K V + +D DE +SV KYGV+G+PTI+ F P Sbjct: 51 WCGHCKKLAPEYEKLGASFKKAKSVLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEP 110 Query: 429 --YQGQRTAEGFVE 464 Y+G R AE E Sbjct: 111 QKYEGPRNAEALAE 124 Score = 37.5 bits (83), Expect = 0.006 Identities = 15/43 (34%), Positives = 29/43 (67%) Frame = +1 Query: 172 DVIELTPSNFDKLLTNSDEIWIIEFFAPGVDIVKALFPNIKKL 300 +V+ LTP NFD+++ + ++ ++EF+AP K+L P +K+ Sbjct: 142 NVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKV 184 Score = 30.3 bits (65), Expect = 0.87 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = +1 Query: 166 SSDVIELTPSNFDKLLTNSDEIWIIEFFAPGVDIVKALFPNIKKL 300 + DV+ LT +F+K + D+ ++EF+AP K L P +KL Sbjct: 22 ADDVVVLTDDSFEKEV-GKDKGALVEFYAPWCGHCKKLAPEYEKL 65 >At1g21750.2 68414.m02723 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 487 Score = 68.1 bits (159), Expect = 4e-12 Identities = 38/76 (50%), Positives = 44/76 (57%), Gaps = 7/76 (9%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALKGIVK---VGALDADE--HRSVSQKYGVTGFPTIKIFT--G 413 WCGHCK L PEY+KAA AL V + +DA E +R + +Y V GFPTIKIF G Sbjct: 58 WCGHCKQLAPEYEKAASALSSNVPPVVLAKIDASEETNREFATQYEVQGFPTIKIFRNGG 117 Query: 414 SKHTPYQGQRTAEGFV 461 Y G R AEG V Sbjct: 118 KAVQEYNGPREAEGIV 133 Score = 40.3 bits (90), Expect = 8e-04 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 3/69 (4%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALK--GIVKVGALDADEHRSVSQKYGVTGFPTIKIFTGSKH-T 425 WCGHC+ L P + A + + V + LDA + + V GFPTI + S + Sbjct: 403 WCGHCQKLAPILDEVAVSYQSDSSVVIAKLDATANDFPKDTFDVKGFPTIYFKSASGNVV 462 Query: 426 PYQGQRTAE 452 Y+G R E Sbjct: 463 VYEGDRQRE 471 Score = 27.5 bits (58), Expect = 6.1 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 2/64 (3%) Frame = +1 Query: 112 YSIGIL-LCATGSLALYDSSSD-VIELTPSNFDKLLTNSDEIWIIEFFAPGVDIVKALFP 285 +SI +L LCA+ + + + V+ L +NF + D I ++EF+AP K L P Sbjct: 9 FSILVLSLCASSIRSEETETKEFVLTLDHTNFTDTINKHDFI-VVEFYAPWCGHCKQLAP 67 Query: 286 NIKK 297 +K Sbjct: 68 EYEK 71 >At1g21750.1 68414.m02722 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 501 Score = 68.1 bits (159), Expect = 4e-12 Identities = 38/76 (50%), Positives = 44/76 (57%), Gaps = 7/76 (9%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALKGIVK---VGALDADE--HRSVSQKYGVTGFPTIKIFT--G 413 WCGHCK L PEY+KAA AL V + +DA E +R + +Y V GFPTIKIF G Sbjct: 58 WCGHCKQLAPEYEKAASALSSNVPPVVLAKIDASEETNREFATQYEVQGFPTIKIFRNGG 117 Query: 414 SKHTPYQGQRTAEGFV 461 Y G R AEG V Sbjct: 118 KAVQEYNGPREAEGIV 133 Score = 46.0 bits (104), Expect = 2e-05 Identities = 25/72 (34%), Positives = 36/72 (50%), Gaps = 3/72 (4%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALK--GIVKVGALDADEHRSVSQKYGVTGFPTIKIFTGSKH-T 425 WCGHC+ L P + A + + V + LDA + + V GFPTI + S + Sbjct: 403 WCGHCQKLAPILDEVAVSYQSDSSVVIAKLDATANDFPKDTFDVKGFPTIYFKSASGNVV 462 Query: 426 PYQGQRTAEGFV 461 Y+G RT E F+ Sbjct: 463 VYEGDRTKEDFI 474 Score = 27.5 bits (58), Expect = 6.1 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 2/64 (3%) Frame = +1 Query: 112 YSIGIL-LCATGSLALYDSSSD-VIELTPSNFDKLLTNSDEIWIIEFFAPGVDIVKALFP 285 +SI +L LCA+ + + + V+ L +NF + D I ++EF+AP K L P Sbjct: 9 FSILVLSLCASSIRSEETETKEFVLTLDHTNFTDTINKHDFI-VVEFYAPWCGHCKQLAP 67 Query: 286 NIKK 297 +K Sbjct: 68 EYEK 71 >At1g77510.1 68414.m09026 protein disulfide isomerase, putative similar to protein disulfide isomerase precursor GB:P29828 GI:4704766 [Medicago sativa]; Pfam HMM hit: PF00085 Thioredoxins Length = 508 Score = 59.3 bits (137), Expect = 2e-09 Identities = 31/76 (40%), Positives = 42/76 (55%), Gaps = 7/76 (9%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALKG---IVKVGALDADE--HRSVSQKYGVTGFPTIKIFT--G 413 WCGHC+ L PEY+KAA L + + +DA E ++ + +Y + GFPT+KI G Sbjct: 57 WCGHCQKLAPEYEKAASELSSHNPPLALAKIDASEEANKEFANEYKIQGFPTLKILRNGG 116 Query: 414 SKHTPYQGQRTAEGFV 461 Y G R AEG V Sbjct: 117 KSVQDYNGPREAEGIV 132 Score = 49.6 bits (113), Expect = 1e-06 Identities = 30/98 (30%), Positives = 47/98 (47%), Gaps = 3/98 (3%) Frame = +3 Query: 207 ITYKFRRNLDH*VLCTWCGHCKSLVPEYKKAARALKG--IVKVGALDADEHRSVSQKYGV 380 I +K +N+ WCGHC+ L P + A + + V + LDA + S + V Sbjct: 385 IVFKSGKNVLIEFYAPWCGHCQKLAPILDEVALSFQNDPSVIIAKLDATANDIPSDTFDV 444 Query: 381 TGFPTIKIFTGSKH-TPYQGQRTAEGFVEAALNAAKEK 491 GFPTI + S + Y+G RT E F+ +++K Sbjct: 445 KGFPTIYFRSASGNVVVYEGDRTKEDFINFVEKNSEKK 482 >At1g43560.1 68414.m05000 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to thioredoxin GI:142153 from [Synechococcus PCC6301] Length = 167 Score = 51.6 bits (118), Expect = 3e-07 Identities = 25/81 (30%), Positives = 42/81 (51%), Gaps = 1/81 (1%) Frame = +3 Query: 252 TWCGHCKSLVPEYKKAARALKGIVKVGALDADEHRSVSQKYGVTGFPTIKIF-TGSKHTP 428 TWCG C+ +VP + + LK I+ V +D +++ S++ KY + PT +F G Sbjct: 86 TWCGPCQLMVPILNEVSETLKDIIAVVKIDTEKYPSLANKYQIEALPTFILFKDGKLWDR 145 Query: 429 YQGQRTAEGFVEAALNAAKEK 491 ++G A VE N+ + K Sbjct: 146 FEGALPANQLVERIENSLQVK 166 >At1g76760.1 68414.m08933 thioredoxin family protein similar to thioredoxin CH2, M-type, chloroplast precursor GB:P23400 SP|P23400 [Chlamydomonas reinhardtii]; contains Pfam profile: PF00085 Thioredoxin Length = 172 Score = 51.2 bits (117), Expect = 4e-07 Identities = 23/81 (28%), Positives = 44/81 (54%), Gaps = 1/81 (1%) Frame = +3 Query: 252 TWCGHCKSLVPEYKKAARALKGIVKVGALDADEHRSVSQKYGVTGFPTIKIF-TGSKHTP 428 TWCG C+ +VP + + LK ++V +D +++ S++ KY + PT +F G Sbjct: 91 TWCGPCQFMVPILNEVSETLKDKIQVVKIDTEKYPSIANKYKIEALPTFILFKDGEPCDR 150 Query: 429 YQGQRTAEGFVEAALNAAKEK 491 ++G TA+ ++ ++ K K Sbjct: 151 FEGALTAKQLIQRIEDSLKVK 171 >At1g35620.1 68414.m04425 thioredoxin family protein similar to SP|Q43116 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Ricinus communis}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 50.4 bits (115), Expect = 8e-07 Identities = 24/69 (34%), Positives = 37/69 (53%), Gaps = 3/69 (4%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAA---RALKGIVKVGALDADEHRSVSQKYGVTGFPTIKIFTGSKHT 425 WCGHCK L PE AA LK + + L+AD++ +++K + FPT+ ++ Sbjct: 60 WCGHCKRLNPELDAAAPILAKLKQPIVIAKLNADKYSRLARKIEIDAFPTLMLYNHGVPM 119 Query: 426 PYQGQRTAE 452 Y G R A+ Sbjct: 120 EYYGPRKAD 128 Score = 32.3 bits (70), Expect = 0.22 Identities = 25/70 (35%), Positives = 38/70 (54%), Gaps = 11/70 (15%) Frame = +1 Query: 115 SIGILLC----ATGSLALYDSSSD-------VIELTPSNFDKLLTNSDEIWIIEFFAPGV 261 S+ +LLC T S+++ SS D V+ELT SNFD ++ D I+ ++F+AP Sbjct: 3 SLKLLLCWISFLTLSISISASSDDQFTLDGTVLELTDSNFDSAISTFDCIF-VDFYAPWC 61 Query: 262 DIVKALFPNI 291 K L P + Sbjct: 62 GHCKRLNPEL 71 >At1g52260.1 68414.m05897 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 537 Score = 49.2 bits (112), Expect = 2e-06 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 3/72 (4%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALKGI---VKVGALDADEHRSVSQKYGVTGFPTIKIFTGSKHT 425 WC L+P + +AA ALK I V + +D D + ++ + + GFPT+ +F Sbjct: 105 WCARSAELMPRFAEAATALKEIGSSVLMAKIDGDRYSKIASELEIKGFPTLLLFVNGTSL 164 Query: 426 PYQGQRTAEGFV 461 Y G +AE V Sbjct: 165 TYNGGSSAEDIV 176 >At1g07960.3 68414.m00867 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 48.0 bits (109), Expect = 4e-06 Identities = 28/86 (32%), Positives = 44/86 (51%), Gaps = 6/86 (6%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALKG--IVKVGALDADEHRSVSQKYGVTGFPTIKIF-TGSKHT 425 WC HCK L ++ +A++G ++VG +D R+V K + +PT +F G + + Sbjct: 54 WCKHCKKLGNLWEDLGKAMEGDDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVS 113 Query: 426 PYQGQRTAE---GFVEAALNAAKEKA 494 Y+G+R E FV A EKA Sbjct: 114 KYKGKRDVESLKAFVVEETEKAAEKA 139 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 169 SDVIELTPSNFDKLLTNSDEIWIIEFFAP 255 ++VI LTP F + D W ++F P Sbjct: 25 AEVITLTPETFSDKIKEKDTAWFVKFCVP 53 >At1g07960.2 68414.m00866 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 48.0 bits (109), Expect = 4e-06 Identities = 28/86 (32%), Positives = 44/86 (51%), Gaps = 6/86 (6%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALKG--IVKVGALDADEHRSVSQKYGVTGFPTIKIF-TGSKHT 425 WC HCK L ++ +A++G ++VG +D R+V K + +PT +F G + + Sbjct: 54 WCKHCKKLGNLWEDLGKAMEGDDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVS 113 Query: 426 PYQGQRTAE---GFVEAALNAAKEKA 494 Y+G+R E FV A EKA Sbjct: 114 KYKGKRDVESLKAFVVEETEKAAEKA 139 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 169 SDVIELTPSNFDKLLTNSDEIWIIEFFAP 255 ++VI LTP F + D W ++F P Sbjct: 25 AEVITLTPETFSDKIKEKDTAWFVKFCVP 53 >At1g07960.1 68414.m00865 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 48.0 bits (109), Expect = 4e-06 Identities = 28/86 (32%), Positives = 44/86 (51%), Gaps = 6/86 (6%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALKG--IVKVGALDADEHRSVSQKYGVTGFPTIKIF-TGSKHT 425 WC HCK L ++ +A++G ++VG +D R+V K + +PT +F G + + Sbjct: 54 WCKHCKKLGNLWEDLGKAMEGDDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVS 113 Query: 426 PYQGQRTAE---GFVEAALNAAKEKA 494 Y+G+R E FV A EKA Sbjct: 114 KYKGKRDVESLKAFVVEETEKAAEKA 139 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 169 SDVIELTPSNFDKLLTNSDEIWIIEFFAP 255 ++VI LTP F + D W ++F P Sbjct: 25 AEVITLTPETFSDKIKEKDTAWFVKFCVP 53 >At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-M2) nearly identical to SP|Q9SEU8 Thioredoxin M-type 2, chloroplast precursor (TRX-M2) {Arabidopsis thaliana} Length = 186 Score = 46.0 bits (104), Expect = 2e-05 Identities = 21/55 (38%), Positives = 28/55 (50%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALKGIVKVGALDADEHRSVSQKYGVTGFPTIKIFTGSK 419 WCG CK + P A+ G +K L+ DE + +YGV PTI IF G + Sbjct: 109 WCGPCKMIDPLVNDLAQHYTGKIKFYKLNTDESPNTPGQYGVRSIPTIMIFVGGE 163 >At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-M4) nearly identical to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana} Length = 193 Score = 43.2 bits (97), Expect = 1e-04 Identities = 17/55 (30%), Positives = 29/55 (52%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALKGIVKVGALDADEHRSVSQKYGVTGFPTIKIFTGSK 419 WCG C+ + P + A+ G K ++ DE + + +YG+ PT+ IF G + Sbjct: 115 WCGPCRMIHPIVDQLAKDFAGKFKFYKINTDESPNTANRYGIRSVPTVIIFKGGE 169 >At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-M1) nearly identical to SP|O48737 Thioredoxin M-type 1, chloroplast precursor (TRX-M1) {Arabidopsis thaliana}; similar to ESTs gb|T13714, gb|H76398, gb|N37762, gb|AA042639, gb|T21104, emb|Z30901 Length = 179 Score = 43.2 bits (97), Expect = 1e-04 Identities = 20/55 (36%), Positives = 27/55 (49%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALKGIVKVGALDADEHRSVSQKYGVTGFPTIKIFTGSK 419 WCG CK + P + A+ G K L+ DE + +YGV PTI IF + Sbjct: 103 WCGPCKMIDPIVNELAQKYAGQFKFYKLNTDESPATPGQYGVRSIPTIMIFVNGE 157 Score = 27.5 bits (58), Expect = 6.1 Identities = 12/49 (24%), Positives = 27/49 (55%) Frame = +1 Query: 160 DSSSDVIELTPSNFDKLLTNSDEIWIIEFFAPGVDIVKALFPNIKKLPE 306 D+++ + + S +D L+ +DE ++F+AP K + P + +L + Sbjct: 71 DTATGIPVVNDSTWDSLVLKADEPVFVDFWAPWCGPCKMIDPIVNELAQ 119 >At3g16110.1 68416.m02035 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 534 Score = 42.7 bits (96), Expect = 2e-04 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 3/72 (4%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALKGI---VKVGALDADEHRSVSQKYGVTGFPTIKIFTGSKHT 425 WC L+P + +AA LK I V + +D + + V+ + + GFPT+ +F Sbjct: 103 WCARSAELMPRFAEAATDLKEIGSSVLMAKIDGERYSKVASQLEIKGFPTLLLFVNGTSQ 162 Query: 426 PYQGQRTAEGFV 461 Y G ++E V Sbjct: 163 SYTGGFSSEEIV 174 >At1g34780.1 68414.m04329 protein disulfide isomerase-related contains weak similarity to Pfam:P08003 protein disulfide isomerase A4 precursor (Protein ERp-72, ERp72) [Mus musculus] Length = 310 Score = 38.7 bits (86), Expect = 0.002 Identities = 18/70 (25%), Positives = 29/70 (41%) Frame = +3 Query: 252 TWCGHCKSLVPEYKKAARALKGIVKVGALDADEHRSVSQKYGVTGFPTIKIFTGSKHTPY 431 +WC +S P + + I ++ S KYGV GFPT+ + + Y Sbjct: 91 SWCPFSRSFRPSFDVISSLYSSIPHFAIKESSIKPSTLSKYGVHGFPTLLLLNSTMRARY 150 Query: 432 QGQRTAEGFV 461 +G R + V Sbjct: 151 RGTRMLDSLV 160 >At4g08930.1 68417.m01470 thioredoxin-related contains weak similarity to Swiss-Prot:Q39239 thioredoxin H-type 4 (TRX-H-4). [Mouse-ear cress] Length = 295 Score = 38.3 bits (85), Expect = 0.003 Identities = 18/70 (25%), Positives = 30/70 (42%) Frame = +3 Query: 252 TWCGHCKSLVPEYKKAARALKGIVKVGALDADEHRSVSQKYGVTGFPTIKIFTGSKHTPY 431 +WC + + P + + + ++ S KYGV GFPTI + + Y Sbjct: 84 SWCPFSRLVRPSFDLMSLLYSSVPHFAIEESSVKASTLSKYGVHGFPTIILMNSTMLVVY 143 Query: 432 QGQRTAEGFV 461 +G RT + V Sbjct: 144 RGSRTLDSLV 153 >At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 178 Score = 38.3 bits (85), Expect = 0.003 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALKGIVKVGALDAD-EHRSVSQKYGVTGFPTIKIFTGSK 419 WCG CK + P+YK + +V + LD + ++R ++++ G+ PT KI +K Sbjct: 98 WCGPCKVIAPKYKALSEKYDDVVFL-KLDCNPDNRPLAKELGIRVVPTFKILKDNK 152 >At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 185 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/55 (27%), Positives = 31/55 (56%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALKGIVKVGALDADEHRSVSQKYGVTGFPTIKIFTGSK 419 WCG CK + P+YK+ + + +V + +++ ++++ G+ PT KI +K Sbjct: 108 WCGPCKVIAPKYKELSEKYQDMVFLKLDCNQDNKPLAKELGIRVVPTFKILKDNK 162 >At1g50320.1 68414.m05641 thioredoxin x nearly identical to thioredoxin x GB:AAF15952 GI:6539616 from [Arabidopsis thaliana] Length = 182 Score = 37.5 bits (83), Expect = 0.006 Identities = 23/84 (27%), Positives = 37/84 (44%) Frame = +3 Query: 246 LCTWCGHCKSLVPEYKKAARALKGIVKVGALDADEHRSVSQKYGVTGFPTIKIFTGSKHT 425 + TWCG CK + P + ++ + + +D D + + ++ V G P +F K Sbjct: 95 VATWCGPCKLIYPAMEALSQEYGDKLTIVKIDHDANPKLIAEFKVYGLPHFILFKDGKEV 154 Query: 426 PYQGQRTAEGFVEAALNAAKEKAY 497 P G R E A+ AK K Y Sbjct: 155 P--GSRR-----EGAITKAKLKEY 171 >At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identical to SP|P29448 Thioredoxin H-type 1 (TRX-H-1) {Arabidopsis thaliana} Length = 114 Score = 36.3 bits (80), Expect = 0.013 Identities = 15/56 (26%), Positives = 28/56 (50%) Frame = +3 Query: 252 TWCGHCKSLVPEYKKAARALKGIVKVGALDADEHRSVSQKYGVTGFPTIKIFTGSK 419 +WCG C+ + P + A+ L ++ + +D DE +SV+ + + PT K Sbjct: 38 SWCGPCRFIAPFFADLAKKLPNVLFL-KVDTDELKSVASDWAIQAMPTFMFLKEGK 92 >At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) identical to SP|Q39239 Thioredoxin H-type 4 (TRX-H-4) {Arabidopsis thaliana} Length = 119 Score = 35.9 bits (79), Expect = 0.017 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = +3 Query: 252 TWCGHCKSLVPEYKKAARALKGIVKVGALDADEHRSVSQKYGVTGFPT 395 +WC C+ + P + A+ +D DE +SV++++GV PT Sbjct: 38 SWCPPCRMIAPIFNDLAKKFMSSAIFFKVDVDELQSVAKEFGVEAMPT 85 >At4g27080.1 68417.m03893 thioredoxin family protein contains Pfam PF00085: Thioredoxin Length = 480 Score = 35.1 bits (77), Expect = 0.031 Identities = 25/92 (27%), Positives = 42/92 (45%), Gaps = 18/92 (19%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALK--------GIVKVGALDADEHRSVSQKYGVTGFPTIKIF- 407 WC C L P ++KAA+ +K G V + +D + + ++ + G+P+I+IF Sbjct: 169 WCYWCNLLKPSWEKAAKQIKERYDPEMDGRVILAKVDCTQEGDLCRRNHIQGYPSIRIFR 228 Query: 408 TGS---------KHTPYQGQRTAEGFVEAALN 476 GS H Y G R E V+ ++ Sbjct: 229 KGSDLKDDNAHHDHESYYGDRDTESLVKMVVS 260 >At1g52990.1 68414.m05997 thioredoxin family protein similar to SP|P48384 Thioredoxin M-type, chloroplast precursor (TRX-M) {Pisum sativum}; contains Pfam profile PF00085: Thioredoxin Length = 313 Score = 34.7 bits (76), Expect = 0.040 Identities = 13/55 (23%), Positives = 26/55 (47%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALKGIVKVGALDADEHRSVSQKYGVTGFPTIKIFTGSK 419 WCG C+ ++P K K K ++ D ++++ ++ PT +F G + Sbjct: 238 WCGPCRDMIPILNKMDSEYKNEFKFYTVNFDTEIRFTERFDISYLPTTLVFKGGE 292 >At4g26160.1 68417.m03765 thioredoxin family protein low similarity to thioredoxin [Ictalurus punctatus] GI:9837585; contains Pfam profile: PF00085 Thioredoxin Length = 221 Score = 34.3 bits (75), Expect = 0.053 Identities = 15/55 (27%), Positives = 30/55 (54%) Frame = +3 Query: 252 TWCGHCKSLVPEYKKAARALKGIVKVGALDADEHRSVSQKYGVTGFPTIKIFTGS 416 TWCG C+++ P+ K A+ I+ + ++ DE++S+ + V P + G+ Sbjct: 123 TWCGSCRAMFPKLCKTAKEHPNILFL-KVNFDENKSLCKSLNVKVLPYFHFYRGA 176 >At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-M3) identical to SP|Q9SEU7 Thioredoxin M-type 3, chloroplast precursor (TRX-M3) {Arabidopsis thaliana} Length = 173 Score = 34.3 bits (75), Expect = 0.053 Identities = 18/73 (24%), Positives = 32/73 (43%), Gaps = 1/73 (1%) Frame = +3 Query: 252 TWCGHCKSLVPEYKKAARALKGIVKVGALDADEHRSVSQKYGVTGFPTIKIF-TGSKHTP 428 +WCG C+ + + A G + L+AD V+++Y + P + +F G K Sbjct: 94 SWCGPCRMVHRIIDEIAGDYAGKLNCYLLNADNDLPVAEEYEIKAVPVVLLFKNGEKRES 153 Query: 429 YQGQRTAEGFVEA 467 G E ++ A Sbjct: 154 IMGTMPKEFYISA 166 >At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) identical to SP|Q39241 Thioredoxin H-type 5 (TRX-H-5) {Arabidopsis thaliana}; identical to cDNA (TOUL) mRNA for thioredoxin GI:992965 Length = 118 Score = 34.3 bits (75), Expect = 0.053 Identities = 14/48 (29%), Positives = 27/48 (56%) Frame = +3 Query: 252 TWCGHCKSLVPEYKKAARALKGIVKVGALDADEHRSVSQKYGVTGFPT 395 +WC C+ + P + + A+ +V +D DE ++V+Q++ V PT Sbjct: 37 SWCPPCRFIAPVFAEMAKKFTNVVFF-KIDVDELQAVAQEFKVEAMPT 83 >At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) identical to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; identical to cDNA (Gif2) mRNA for thioredoxin GI:992963 Length = 133 Score = 33.9 bits (74), Expect = 0.071 Identities = 17/56 (30%), Positives = 26/56 (46%) Frame = +3 Query: 252 TWCGHCKSLVPEYKKAARALKGIVKVGALDADEHRSVSQKYGVTGFPTIKIFTGSK 419 +WCG C+ + P A + V LD DE V++++ VT PT + K Sbjct: 57 SWCGPCRMIEPAIHAMADKFNDVDFV-KLDVDELPDVAKEFNVTAMPTFVLVKRGK 111 >At3g20560.1 68416.m02603 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 483 Score = 33.9 bits (74), Expect = 0.071 Identities = 25/88 (28%), Positives = 41/88 (46%), Gaps = 18/88 (20%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALK--------GIVKVGALDADEHRSVSQKYGVTGFPTIKIF- 407 WC L P ++KAA +K G V +G +D E ++ ++ + G+P+I+IF Sbjct: 169 WCYWSNRLKPSWEKAANIIKQRYDPEADGRVLLGNVDCTEEPALCKRNHIQGYPSIRIFR 228 Query: 408 TGS---------KHTPYQGQRTAEGFVE 464 GS +H Y G R + V+ Sbjct: 229 KGSDLREDHGHHEHESYYGDRDTDSIVK 256 >At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / PAPS reductase homolog (PRH19) identical to 5'-adenylylsulfate reductase [Arabidopsis thaliana] GI:2738756; identical to cDNA PAPS reductase homolog (PRH19) GI:1710111 Length = 465 Score = 33.5 bits (73), Expect = 0.093 Identities = 18/61 (29%), Positives = 28/61 (45%), Gaps = 3/61 (4%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALKGI-VKVGAL--DADEHRSVSQKYGVTGFPTIKIFTGSKHT 425 WC C+++ Y + A L G +KV D D+ Q+ + FPTI +F + Sbjct: 384 WCPFCQAMEASYDELADKLAGSGIKVAKFRADGDQKEFAKQELQLGSFPTILVFPKNSSR 443 Query: 426 P 428 P Sbjct: 444 P 444 >At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to tetratricoredoxin [Arabidopsis thaliana] GI:18041544; similar to SP|Q42443 Thioredoxin H-type (TRX-H) (Phloem sap 13 kDa protein-1) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 380 Score = 32.3 bits (70), Expect = 0.22 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = +3 Query: 252 TWCGHCKSLVPEYKKAARALKGIVKVGALDADEHRSVSQKYGVTGFPT 395 TWCG C+ + P Y A +V + +D D+ V+ + ++ PT Sbjct: 302 TWCGPCRYMSPLYSNLATQHSRVVFL-KVDIDKANDVAASWNISSVPT 348 >At2g41680.1 68415.m05149 thioredoxin reductase, putative / NADPH-dependent thioredoxin reductase, putative The last 2 exons encode thioredoxin. There is an EST match to exons 5-7, and the distance between exon 7 and exon 8 is only 90bp. It is unlikely this is two separate genes, but more likely a hybrid protein. Length = 529 Score = 31.9 bits (69), Expect = 0.28 Identities = 13/50 (26%), Positives = 24/50 (48%) Frame = +3 Query: 258 CGHCKSLVPEYKKAARALKGIVKVGALDADEHRSVSQKYGVTGFPTIKIF 407 CG C++L P K V +D +E + +++ G+ G P ++ F Sbjct: 454 CGPCRTLKPILNKVVDEYNHDVHFVEIDIEEDQEIAEAAGIMGTPCVQFF 503 >At4g12170.1 68417.m01934 thioredoxin family protein similar to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 128 Score = 31.1 bits (67), Expect = 0.50 Identities = 14/54 (25%), Positives = 26/54 (48%) Frame = +3 Query: 258 CGHCKSLVPEYKKAARALKGIVKVGALDADEHRSVSQKYGVTGFPTIKIFTGSK 419 C C SL+PE + + ++K +D DE +++ Y + P +F G + Sbjct: 54 CAECGSLMPELEFLDSEYEYMLKFYTVDTDEELELAKDYRIEYHPITIVFKGGE 107 >At1g08570.1 68414.m00950 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to ESTs gb|T46281, gb|R83933, gb|N65879, emb|F14466, gb|N96726, gb|AA042340, and emb|Z18150 Length = 275 Score = 31.1 bits (67), Expect = 0.50 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +1 Query: 202 DKLLTNSDEIWIIEFFAPGVDIVKALFPNIKKLPEL 309 D L D++ +++FF+PG KAL P I + E+ Sbjct: 110 DSLTNAGDKLVVVDFFSPGCGGCKALHPKICQFAEM 145 >At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 148 Score = 30.7 bits (66), Expect = 0.66 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALKGIVKVGALDADEHRSVSQKYGVTGFPTI 398 WCG CK+L P+ ++ A + V +D D SV ++ ++ P I Sbjct: 70 WCGPCKTLEPKLEELAAKYTDVEFV-KIDVDVLMSVWMEFNLSTLPAI 116 >At3g56420.1 68416.m06275 thioredoxin family protein similar to thioredoxin [Nicotiana tabacum] GI:20047; contains Pfam profile: PF00085 Thioredoxin Length = 100 Score = 29.9 bits (64), Expect = 1.1 Identities = 17/67 (25%), Positives = 29/67 (43%), Gaps = 1/67 (1%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALKGIVKVGALDADEHRSVSQKYGVTGFPTIKIF-TGSKHTPY 431 WC CK + P ++ A ++ V +D +E S ++ V PT+ G + Sbjct: 19 WCVPCKKIEPVFRDLASRYPSMIFV-TVDVEELAEFSNEWNVEATPTVVFLKDGRQMDKL 77 Query: 432 QGQRTAE 452 G T+E Sbjct: 78 VGAETSE 84 >At4g29670.2 68417.m04227 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 236 Score = 29.5 bits (63), Expect = 1.5 Identities = 15/55 (27%), Positives = 27/55 (49%) Frame = +3 Query: 252 TWCGHCKSLVPEYKKAARALKGIVKVGALDADEHRSVSQKYGVTGFPTIKIFTGS 416 TWC C++L P+ K A IV + ++ DE++ + + V P + G+ Sbjct: 133 TWCASCRALFPKLCKTAVEHPDIVFL-KVNFDENKPMCKSLNVRVLPFFHFYRGA 186 >At4g29670.1 68417.m04226 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 235 Score = 29.5 bits (63), Expect = 1.5 Identities = 15/55 (27%), Positives = 27/55 (49%) Frame = +3 Query: 252 TWCGHCKSLVPEYKKAARALKGIVKVGALDADEHRSVSQKYGVTGFPTIKIFTGS 416 TWC C++L P+ K A IV + ++ DE++ + + V P + G+ Sbjct: 133 TWCASCRALFPKLCKTAVEHPDIVFL-KVNFDENKPMCKSLNVRVLPFFHFYRGA 186 >At3g06730.1 68416.m00798 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 183 Score = 29.5 bits (63), Expect = 1.5 Identities = 13/49 (26%), Positives = 22/49 (44%) Frame = +3 Query: 252 TWCGHCKSLVPEYKKAARALKGIVKVGALDADEHRSVSQKYGVTGFPTI 398 TWCG C + E + A + + +D D+ ++ V G PT+ Sbjct: 104 TWCGPCILMAQELEMLAVEYESNAIIVKVDTDDEYEFARDMQVRGLPTL 152 >At1g76810.1 68414.m08938 eukaryotic translation initiation factor 2 family protein / eIF-2 family protein similar to IF2 protein [Drosophila melanogaster] GI:7108770; contains Pfam profile PF03144: Elongation factor Tu domain 2 Length = 1294 Score = 29.5 bits (63), Expect = 1.5 Identities = 17/65 (26%), Positives = 30/65 (46%), Gaps = 2/65 (3%) Frame = +3 Query: 291 KKAARALKG--IVKVGALDADEHRSVSQKYGVTGFPTIKIFTGSKHTPYQGQRTAEGFVE 464 KK ++ KG V LD ++ + ++ G + FTG KH +G++ F Sbjct: 103 KKKSKGKKGGGSVSFALLDDEDEKEDNESDGDKDDEPVISFTGKKHASKKGKKGGNSFAA 162 Query: 465 AALNA 479 +A +A Sbjct: 163 SAFDA 167 >At3g08710.1 68416.m01012 thioredoxin family protein similar to thioredoxin H-type GB:P29448 SP|P29448 [Arabidopsis thaliana], Thioredoxin H-type 2 (TRX-H2) SP|Q07090 {Nicotiana tabacum}; contains Pfam profile: PF00085 Thioredoxin Length = 140 Score = 29.1 bits (62), Expect = 2.0 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = +3 Query: 252 TWCGHCKSLVPEYKKAARALKGIVKVGALDADEHRSVSQKYGVTGFPT 395 TWCG CK + P + + + ++ + +D DE S + + PT Sbjct: 55 TWCGPCKIVAPFFIELSEKHSSLMFL-LVDVDELSDFSSSWDIKATPT 101 >At3g03860.1 68416.m00398 expressed protein Length = 300 Score = 29.1 bits (62), Expect = 2.0 Identities = 13/71 (18%), Positives = 31/71 (43%) Frame = +3 Query: 252 TWCGHCKSLVPEYKKAARALKGIVKVGALDADEHRSVSQKYGVTGFPTIKIFTGSKHTPY 431 +WC +++ P++ + I + + SV +YG+ P+I + + + Y Sbjct: 84 SWCPFSRAVRPKFDMLSSMFPQIQHLAVEHSQALPSVFSRYGIHSLPSILMVNQTLNARY 143 Query: 432 QGQRTAEGFVE 464 G++ +E Sbjct: 144 HGRKDLISLIE 154 >At4g21990.1 68417.m03183 5'-adenylylsulfate reductase (APR3) / PAPS reductase homolog (PRH26) identical to 5'-adenylylsulfate reductase [Arabidopsis thaliana] GI:2738760; identical to cDNA PAPS reductase homolog (PRH26) GI:1710113 Length = 458 Score = 28.3 bits (60), Expect = 3.5 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Frame = +1 Query: 139 TGSLALYDSSSDVIELTPSNFDKL--LTNSDEIWIIEFFAPGVDIVKALFPNIKKLPE 306 T S+A +S +V+ L+ + L L N E WI+ +AP +A+ + +L + Sbjct: 336 TASVADIFNSENVVNLSRQGIENLMKLENRKEAWIVVLYAPWCPFCQAMEASFDELAD 393 >At1g15020.2 68414.m01795 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 528 Score = 28.3 bits (60), Expect = 3.5 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = +1 Query: 160 DSSSDVIELTPSNFDKLLTNSDEIW-IIEFFAPGVDIVKALFPNIKKLPEL 309 D + IEL +NFD + +S + ++EFFA + P+ +K+ L Sbjct: 38 DQKDNAIELNATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEKVARL 88 Score = 27.9 bits (59), Expect = 4.6 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALKG 317 WC C++ P Y+K AR G Sbjct: 71 WCPACRNYKPHYEKVARLFNG 91 >At1g15020.1 68414.m01794 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 502 Score = 28.3 bits (60), Expect = 3.5 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = +1 Query: 160 DSSSDVIELTPSNFDKLLTNSDEIW-IIEFFAPGVDIVKALFPNIKKLPEL 309 D + IEL +NFD + +S + ++EFFA + P+ +K+ L Sbjct: 38 DQKDNAIELNATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEKVARL 88 Score = 27.9 bits (59), Expect = 4.6 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALKG 317 WC C++ P Y+K AR G Sbjct: 71 WCPACRNYKPHYEKVARLFNG 91 >At2g33270.1 68415.m04078 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 273 Score = 27.9 bits (59), Expect = 4.6 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +1 Query: 187 TPSNFDKLLTNS-DEIWIIEFFAPGVDIVKALFPNIKKLPE 306 +P + L N+ D++ +++FF+P KAL P I K+ E Sbjct: 100 SPQDLVVSLRNAGDKLVVVDFFSPSCGGCKALHPKICKIAE 140 >At2g01270.1 68415.m00040 thioredoxin family protein low similarity to quiescin [Homo sapiens] GI:13257405; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 495 Score = 27.9 bits (59), Expect = 4.6 Identities = 14/51 (27%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = +1 Query: 160 DSSSDVIELTPSNFDKLLTNSDEIW-IIEFFAPGVDIVKALFPNIKKLPEL 309 D +EL +NFD +L ++ + ++EFFA + P+ +K+ L Sbjct: 32 DQKDKAVELNTTNFDSVLKDTPAKYAVVEFFAHWCPACRNYKPHYEKVARL 82 Score = 27.9 bits (59), Expect = 4.6 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALKG 317 WC C++ P Y+K AR G Sbjct: 65 WCPACRNYKPHYEKVARLFNG 85 >At3g53220.1 68416.m05864 thioredoxin family protein low similarity to SP|P29451 Thioredoxin [Rhesus macaque] {Macaca mulatta}; contains Pfam profile: PF00085 Thioredoxin Length = 126 Score = 27.5 bits (58), Expect = 6.1 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +3 Query: 252 TWCGHCKSLVPEYKKAARALKGIVKVGALDADE 350 +WCG C ++P ++K + + + V A D DE Sbjct: 53 SWCGVCSQILPAFRKLSNSFSKLKFVYA-DIDE 84 >At2g32760.1 68415.m04008 expressed protein Length = 352 Score = 27.5 bits (58), Expect = 6.1 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Frame = +1 Query: 130 LCATGSLALYDSSSDVIELTPSNFDKLLTNSDEIWIIEF--FAPGVDIVKALF 282 LC GS + IE +PS+ + T S I +EF F G D +A + Sbjct: 254 LCLGGSKTYIRDYAPYIEPSPSDMSPITTLSQNINFVEFPLFLDGQDTTRAAY 306 >At1g29790.1 68414.m03642 expressed protein Length = 378 Score = 27.5 bits (58), Expect = 6.1 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +1 Query: 175 VIELTPSNFDKLLTNSDEIWIIEFFAPGVDIVKALFPNIKKL 300 V+E + D++L +W+ FF+ VD+ P I KL Sbjct: 305 VMEFFFFDLDRILRGGGYLWLDRFFSKKVDLENVYAPMIGKL 346 >At1g27600.2 68414.m03368 glycosyl transferase family 43 protein similar to Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1, Rattus norvegicus [SP|O35789], Homo sapiens [SP|Q9P2W7]; contains Pfam domain Glycosyltransferase family 43 [PF03360] Length = 394 Score = 27.5 bits (58), Expect = 6.1 Identities = 15/34 (44%), Positives = 24/34 (70%) Frame = -1 Query: 281 NKAFTMSTPGAKNSMIQISSEFVSNLSKLLGVSS 180 +K FT+ +K++ SS+F+S L+KLLGV+S Sbjct: 23 HKGFTIGGSSSKHN----SSQFLSYLTKLLGVTS 52 >At5g11640.1 68418.m01361 expressed protein predicted proteins, Drosophila melanogaster and Homo sapiens Length = 253 Score = 27.1 bits (57), Expect = 8.1 Identities = 12/26 (46%), Positives = 18/26 (69%), Gaps = 2/26 (7%) Frame = +1 Query: 181 ELTPSNFDKLLT--NSDEIWIIEFFA 252 +LTP + LL+ N+ + W+IEFFA Sbjct: 125 KLTPMQLEDLLSDGNTTKYWLIEFFA 150 >At4g30610.1 68417.m04342 serine carboxypeptidase S10 family protein similar to Serine carboxypeptidase II chains A and B (SP:P08819) (EC 3.4.16.6) [Triticum aestivum (Wheat)]; Length = 465 Score = 27.1 bits (57), Expect = 8.1 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +3 Query: 36 CCESRSQKFYNRLFINSVKFHNVTRIFNRYLALCNGVL 149 C ES ++K++NR + NVT I ++ A C+ VL Sbjct: 317 CTESYAEKYFNRPDVQRAMHANVTGIRYKWTA-CSDVL 353 >At1g50950.1 68414.m05728 thioredoxin-related contains weak hit to Pfam PF00085: Thioredoxin; contains 2 predicted transmembrane domains Length = 484 Score = 27.1 bits (57), Expect = 8.1 Identities = 22/88 (25%), Positives = 39/88 (44%), Gaps = 18/88 (20%) Frame = +3 Query: 255 WCGHCKSLVPEYKKAARALK--------GIVKVGALDADEHRSVSQKYGVTGFPTIKIF- 407 WC L P + KA++ + V +G++D E ++ + + G+P+I+IF Sbjct: 170 WCYWSNRLKPSWVKASQITRERYNPGTDDRVLLGSVDCTEEPTLCKSNHIQGYPSIRIFR 229 Query: 408 TGS---------KHTPYQGQRTAEGFVE 464 GS +H Y G R + V+ Sbjct: 230 RGSGLREDHGNHEHESYYGDRDTDSLVK 257 >At1g11490.1 68414.m01320 zinc finger (C2H2 type) family protein contains zinc finger, C2H2 type, domain, PROSITE:PS00028 Length = 365 Score = 27.1 bits (57), Expect = 8.1 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +3 Query: 30 VVCCESRSQKFYNRLFINSVKFHNVTRIFNRYLALCNG 143 V CC SRS + + F+N+VKF +R+ L +G Sbjct: 64 VSCCSSRSLE--SSRFVNTVKFEENAGYSDRFKGLLSG 99 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,609,778 Number of Sequences: 28952 Number of extensions: 238404 Number of successful extensions: 766 Number of sequences better than 10.0: 61 Number of HSP's better than 10.0 without gapping: 692 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 745 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1013649368 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -