BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0171 (437 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY505417-1|AAR90328.1| 206|Anopheles gambiae superoxide dismuta... 23 3.6 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 23 6.3 >AY505417-1|AAR90328.1| 206|Anopheles gambiae superoxide dismutase 1 protein. Length = 206 Score = 23.4 bits (48), Expect = 3.6 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +2 Query: 5 HRAYQRVAGLNAKPEVLFILVQKRHHTRFFLPGNNARFN 121 H AY V LNA E L V K+ ++ GN +FN Sbjct: 63 HNAY--VTNLNAAEEQLQDAVAKQDVSKIIQLGNAIKFN 99 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 22.6 bits (46), Expect = 6.3 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 59 ILVQKRHHTRFFLPGNNARFNV 124 I +Q+ +HT LPG N NV Sbjct: 47 IFLQEVYHTDLALPGYNVLSNV 68 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 472,207 Number of Sequences: 2352 Number of extensions: 9072 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 36568146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -