BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0163 (719 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024800-5|AAF60724.1| 966|Caenorhabditis elegans Hypothetical ... 31 0.83 AF016442-8|AAB65916.1| 881|Caenorhabditis elegans Hypothetical ... 28 5.8 >AC024800-5|AAF60724.1| 966|Caenorhabditis elegans Hypothetical protein Y49F6A.1 protein. Length = 966 Score = 31.1 bits (67), Expect = 0.83 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Frame = -3 Query: 345 VVSENGKTR*RICYKLRAKLSGANYIV-I*QTFG-SVQVSSRSFKLKPCRD 199 ++S NG+T + KL K G NYIV + Q+F +V S+ SF K D Sbjct: 624 IISGNGQTAGNVIKKLNLKCGGINYIVEVPQSFNRTVVCSNNSFVQKKLFD 674 >AF016442-8|AAB65916.1| 881|Caenorhabditis elegans Hypothetical protein K12B6.1 protein. Length = 881 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 366 IKFRNLIVVSENGKTR*RICYKLRAKLSGANY 271 I+F + +++ TR I YK KL G NY Sbjct: 578 IRFETAVKLAQQQNTRKNIIYKTNMKLGGLNY 609 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,069,846 Number of Sequences: 27780 Number of extensions: 301524 Number of successful extensions: 580 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 567 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 580 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1687292480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -