BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0163 (719 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g01350.1 68417.m00175 DC1 domain-containing protein contains ... 32 0.33 At1g13230.1 68414.m01535 leucine-rich repeat family protein cont... 27 9.5 >At4g01350.1 68417.m00175 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 652 Score = 32.3 bits (70), Expect = 0.33 Identities = 16/28 (57%), Positives = 19/28 (67%) Frame = +2 Query: 347 IKFRNLMNQRNPRSLCTR*LQSRCKVSV 430 +KF + N RN R LC + QSRCKVSV Sbjct: 600 VKFGAVPNNRNTRPLCIQ-CQSRCKVSV 626 >At1g13230.1 68414.m01535 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to gb|U42445 Cf-2.2 from Lycopersicon pimpinellifolium Length = 424 Score = 27.5 bits (58), Expect = 9.5 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = -1 Query: 704 ISNGRVGIISLTGTAWGKKSNKMKLMTQGM*FYNEIFNSI 585 +SN +G + GT WGK SN + L M EI S+ Sbjct: 294 LSNNPMGEEDMVGTNWGKMSNLVVLDLSKMGLRGEIPTSL 333 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,776,582 Number of Sequences: 28952 Number of extensions: 261939 Number of successful extensions: 424 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 420 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 424 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1565336320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -