BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0159 (679 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC548.05c |||ubiquitin-protein ligase E3 |Schizosaccharomyces ... 27 1.9 SPAC1F3.08c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 26 4.4 >SPCC548.05c |||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 468 Score = 27.5 bits (58), Expect = 1.9 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = -2 Query: 543 NWMREAKDCAQCEQ-LERPLCPAVGCYTLMMTV 448 NW++E+K C C Q L PA Y +M V Sbjct: 111 NWLKESKSCPTCRQKLYTQPSPAYLVYEIMNVV 143 >SPAC1F3.08c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 108 Score = 26.2 bits (55), Expect = 4.4 Identities = 11/34 (32%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = +2 Query: 362 YKKLFHLEKICYDFADII*LIEM-ILYIFHTVII 460 Y F ++ICYD+ +I+ E+ I+Y ++ ++I Sbjct: 42 YSIPFFYDRICYDYKNILLKYELFIIYYYYYLLI 75 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,512,808 Number of Sequences: 5004 Number of extensions: 44625 Number of successful extensions: 85 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 85 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 85 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 311890690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -