BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0159 (679 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0956 - 22869166-22871145,22871800-22871959,22872311-228723... 30 1.5 10_01_0307 + 3382432-3382608,3382690-3382863,3383600-3383695,338... 29 2.6 >07_03_0956 - 22869166-22871145,22871800-22871959,22872311-22872375, 22872464-22872529,22872634-22872691,22872834-22872925, 22873093-22873332 Length = 886 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -3 Query: 419 VKLCQRNHSKFFQDEITFCSILLRAGARDKLNSTE 315 + LCQ + + Q+ T C +++ +DKLN TE Sbjct: 198 IDLCQLQNRDYSQEIFTACQVVIELIPKDKLNFTE 232 >10_01_0307 + 3382432-3382608,3382690-3382863,3383600-3383695, 3384640-3384709,3385878-3386002,3387128-3387268, 3387362-3387519,3387644-3387803,3390136-3390213, 3390326-3390385,3390473-3390528,3391886-3392090, 3394107-3394192,3394296-3394406,3394536-3394607, 3395453-3395538,3395730-3395878,3396107-3396250, 3396335-3396442,3396997-3397027,3397609-3397713, 3398283-3398407,3398807-3398950,3399073-3399177, 3400748-3400799,3401549-3401696,3401936-3402130, 3402404-3402647,3403152-3403259,3403887-3404034, 3405467-3405525,3405876-3405945,3407008-3407333, 3407666-3409204,3410526-3410733,3410870-3410906, 3411024-3411072,3411143-3411271 Length = 2025 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/42 (40%), Positives = 24/42 (57%) Frame = -1 Query: 271 LNT*NSKKRNSLKFSIRFQ*FRSLTDCVLSLQRFYSRYHIPR 146 +NT SKKR L+ S SLT+ +L+L ++YH PR Sbjct: 1684 VNTHQSKKRTLLQKSQTSLSALSLTENILTLLCILAKYHFPR 1725 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,433,815 Number of Sequences: 37544 Number of extensions: 256286 Number of successful extensions: 395 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 390 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 395 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1726796312 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -