BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0158 (683 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|... 43 0.006 UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bomb... 33 4.9 >UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|Rep: NADPH oxidoreductase - Bombyx mori (Silk moth) Length = 191 Score = 43.2 bits (97), Expect = 0.006 Identities = 23/37 (62%), Positives = 27/37 (72%), Gaps = 6/37 (16%) Frame = +2 Query: 2 LLLR*MDDLTAHLVLS------DIYNVNTPPTLRYKF 94 LLLR +D+LTAHLVLS +Y+VN PPT RYKF Sbjct: 155 LLLRWVDELTAHLVLSGYWSPRHLYDVNAPPTSRYKF 191 Score = 40.7 bits (91), Expect = 0.032 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = -1 Query: 515 FIMLRWVNGLTAHLVLSGYRSP 450 F++LRWV+ LTAHLVLSGY SP Sbjct: 154 FLLLRWVDELTAHLVLSGYWSP 175 >UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bombyx mori (Silk moth) Length = 782 Score = 33.5 bits (73), Expect = 4.9 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +2 Query: 176 WWLPVRTHKRSYRQYKYKF 232 W+LP RTHKRSY +Y+ + Sbjct: 572 WYLPARTHKRSYHRYQCSY 590 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 643,650,715 Number of Sequences: 1657284 Number of extensions: 11508344 Number of successful extensions: 20275 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19835 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20273 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 53305790091 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -