BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0158 (683 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44949| Best HMM Match : LIM (HMM E-Value=0.44) 31 1.1 SB_32075| Best HMM Match : LIM (HMM E-Value=0.44) 31 1.1 SB_31020| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_41935| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_3854| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_39998| Best HMM Match : Peptidase_C1 (HMM E-Value=0) 29 2.7 SB_36584| Best HMM Match : ResIII (HMM E-Value=0.95) 29 3.5 SB_28796| Best HMM Match : LIM (HMM E-Value=5.2) 29 3.5 SB_47739| Best HMM Match : WCCH (HMM E-Value=3.5) 29 3.5 SB_2065| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_55881| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_58867| Best HMM Match : Bombesin (HMM E-Value=2.2) 28 6.1 SB_56271| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_56228| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_55327| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_53550| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_53052| Best HMM Match : U79_P34 (HMM E-Value=2.7) 28 6.1 SB_53010| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_50679| Best HMM Match : Tombus_P19 (HMM E-Value=2.1) 28 6.1 SB_48331| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_46599| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_46403| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_45754| Best HMM Match : ResIII (HMM E-Value=6.2) 28 6.1 SB_44664| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_41497| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_39466| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_38850| Best HMM Match : ResIII (HMM E-Value=0.045) 28 6.1 SB_36475| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_34782| Best HMM Match : zf-CHY (HMM E-Value=0.36) 28 6.1 SB_34067| Best HMM Match : SPAN-X (HMM E-Value=2.7) 28 6.1 SB_33054| Best HMM Match : DEAD (HMM E-Value=0.42) 28 6.1 SB_33051| Best HMM Match : PADR1 (HMM E-Value=1.2) 28 6.1 SB_30838| Best HMM Match : ResIII (HMM E-Value=0.13) 28 6.1 SB_29698| Best HMM Match : DUF1610 (HMM E-Value=4.6) 28 6.1 SB_29289| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_28291| Best HMM Match : DUF1131 (HMM E-Value=2.3) 28 6.1 SB_27649| Best HMM Match : ResIII (HMM E-Value=0.43) 28 6.1 SB_25225| Best HMM Match : DEAD (HMM E-Value=1.4) 28 6.1 SB_23107| Best HMM Match : ResIII (HMM E-Value=0.045) 28 6.1 SB_22826| Best HMM Match : F5_F8_type_C (HMM E-Value=7.9e-09) 28 6.1 SB_21356| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_20530| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_20292| Best HMM Match : DUF495 (HMM E-Value=3.7) 28 6.1 SB_19129| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_17591| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_14541| Best HMM Match : ResIII (HMM E-Value=0.66) 28 6.1 SB_13306| Best HMM Match : PADR1 (HMM E-Value=1.2) 28 6.1 SB_8103| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_7382| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_7259| Best HMM Match : ResIII (HMM E-Value=0.21) 28 6.1 SB_7068| Best HMM Match : ResIII (HMM E-Value=0.29) 28 6.1 SB_3900| Best HMM Match : DUF1070 (HMM E-Value=1) 28 6.1 SB_3753| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_474| Best HMM Match : dsrm (HMM E-Value=3.2e-20) 28 6.1 SB_366| Best HMM Match : ResIII (HMM E-Value=0.28) 28 6.1 SB_59743| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_59334| Best HMM Match : zf-AN1 (HMM E-Value=0.72) 28 6.1 SB_56589| Best HMM Match : zf-C4_Topoisom (HMM E-Value=1.1) 28 6.1 SB_53861| Best HMM Match : LIM (HMM E-Value=0.93) 28 6.1 SB_53789| Best HMM Match : ResIII (HMM E-Value=0.044) 28 6.1 SB_53507| Best HMM Match : DUF1610 (HMM E-Value=2) 28 6.1 SB_52692| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_52546| Best HMM Match : ResIII (HMM E-Value=0.21) 28 6.1 SB_51131| Best HMM Match : ResIII (HMM E-Value=0.36) 28 6.1 SB_50233| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_47012| Best HMM Match : ScdA_N (HMM E-Value=5.3) 28 6.1 SB_45084| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_44503| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_43547| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_42858| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_41929| Best HMM Match : ResIII (HMM E-Value=1.5) 28 6.1 SB_39579| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_36328| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_36310| Best HMM Match : DEAD (HMM E-Value=1.4) 28 6.1 SB_35740| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_31538| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_29783| Best HMM Match : PA14 (HMM E-Value=5e-05) 28 6.1 SB_27544| Best HMM Match : ResIII (HMM E-Value=0.14) 28 6.1 SB_26374| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_25592| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_24250| Best HMM Match : ResIII (HMM E-Value=3.6) 28 6.1 SB_21674| Best HMM Match : LIM (HMM E-Value=0.44) 28 6.1 SB_20407| Best HMM Match : ResIII (HMM E-Value=0.36) 28 6.1 SB_15365| Best HMM Match : U79_P34 (HMM E-Value=1.8) 28 6.1 SB_13172| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_11769| Best HMM Match : Complex1_17_2kD (HMM E-Value=6.6) 28 6.1 SB_9087| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_8850| Best HMM Match : LIM (HMM E-Value=0.51) 28 6.1 SB_6669| Best HMM Match : zf-C4_Topoisom (HMM E-Value=1.2) 28 6.1 SB_5979| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_2770| Best HMM Match : ResIII (HMM E-Value=2.2) 28 6.1 SB_1076| Best HMM Match : Phage_tail_S (HMM E-Value=2.7) 28 6.1 SB_57402| Best HMM Match : DEAD (HMM E-Value=0.42) 28 8.1 SB_56935| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_56636| Best HMM Match : Toxin_4 (HMM E-Value=2.4) 28 8.1 SB_56193| Best HMM Match : RolB_RolC (HMM E-Value=5.3) 28 8.1 SB_56070| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_50726| Best HMM Match : zf-CCHC (HMM E-Value=1.8) 28 8.1 SB_48939| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_47810| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_45057| Best HMM Match : Rhabdo_NV (HMM E-Value=4.1) 28 8.1 SB_40361| Best HMM Match : ResIII (HMM E-Value=0.42) 28 8.1 SB_30566| Best HMM Match : zf-C4_Topoisom (HMM E-Value=0.38) 28 8.1 SB_27946| Best HMM Match : DEAD (HMM E-Value=0.42) 28 8.1 SB_24603| Best HMM Match : GatB_Yqey (HMM E-Value=0.7) 28 8.1 SB_22253| Best HMM Match : Pkinase (HMM E-Value=0) 28 8.1 SB_17486| Best HMM Match : CheR (HMM E-Value=3.2) 28 8.1 SB_15632| Best HMM Match : CBM_5_12 (HMM E-Value=2.9) 28 8.1 SB_9872| Best HMM Match : ResIII (HMM E-Value=0.36) 28 8.1 SB_9659| Best HMM Match : ResIII (HMM E-Value=0.39) 28 8.1 SB_5900| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_4087| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_3096| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_59126| Best HMM Match : zf-A20 (HMM E-Value=4.4) 28 8.1 SB_58059| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_56794| Best HMM Match : ResIII (HMM E-Value=0.63) 28 8.1 SB_54647| Best HMM Match : Phage_tail_S (HMM E-Value=2.4) 28 8.1 SB_53156| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_53060| Best HMM Match : ResIII (HMM E-Value=0.14) 28 8.1 SB_51306| Best HMM Match : Peptidase_C27 (HMM E-Value=0.78) 28 8.1 SB_48412| Best HMM Match : ResIII (HMM E-Value=0.19) 28 8.1 SB_47766| Best HMM Match : Ribosomal_L27 (HMM E-Value=2.3) 28 8.1 SB_42053| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_40200| Best HMM Match : Ribosomal_L27 (HMM E-Value=2.6) 28 8.1 SB_39663| Best HMM Match : ResIII (HMM E-Value=1.1) 28 8.1 SB_35959| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_31859| Best HMM Match : DUF1131 (HMM E-Value=4.3) 28 8.1 SB_31030| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_27423| Best HMM Match : ResIII (HMM E-Value=0.56) 28 8.1 SB_27319| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_27311| Best HMM Match : DEAD (HMM E-Value=0.17) 28 8.1 SB_27173| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_24707| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_24616| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_24369| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_21729| Best HMM Match : Ribosomal_L27 (HMM E-Value=5.7) 28 8.1 SB_15115| Best HMM Match : ResIII (HMM E-Value=0.24) 28 8.1 SB_11429| Best HMM Match : Shikimate_DH (HMM E-Value=7.7) 28 8.1 SB_7073| Best HMM Match : ResIII (HMM E-Value=0.083) 28 8.1 SB_5505| Best HMM Match : ResIII (HMM E-Value=0.55) 28 8.1 SB_4780| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_2121| Best HMM Match : ResIII (HMM E-Value=0.46) 28 8.1 SB_1328| Best HMM Match : PHZA_PHZB (HMM E-Value=3.4) 28 8.1 SB_204| Best HMM Match : ResIII (HMM E-Value=1.2) 28 8.1 >SB_44949| Best HMM Match : LIM (HMM E-Value=0.44) Length = 595 Score = 30.7 bits (66), Expect = 1.1 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +WLPE Sbjct: 110 GEWRHKKPGYEWLPE 124 >SB_32075| Best HMM Match : LIM (HMM E-Value=0.44) Length = 789 Score = 30.7 bits (66), Expect = 1.1 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +WLPE Sbjct: 287 GEWRHKKPGYEWLPE 301 >SB_31020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 680 Score = 29.9 bits (64), Expect = 2.0 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG KW PE Sbjct: 204 GEWRHKKPGYKWRPE 218 >SB_41935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 316 Score = 29.9 bits (64), Expect = 2.0 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG KW PE Sbjct: 47 GEWRHKKPGYKWRPE 61 >SB_3854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 726 Score = 29.9 bits (64), Expect = 2.0 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG KW PE Sbjct: 545 GEWRHKKPGYKWRPE 559 >SB_39998| Best HMM Match : Peptidase_C1 (HMM E-Value=0) Length = 1220 Score = 29.5 bits (63), Expect = 2.7 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -3 Query: 498 GEWAHGPPGVKWLPEPIDIY 439 GEW H PG +W P+ + +Y Sbjct: 895 GEWRHKKPGYEWRPKRLGMY 914 >SB_36584| Best HMM Match : ResIII (HMM E-Value=0.95) Length = 1244 Score = 29.1 bits (62), Expect = 3.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 730 GEWCHKKPGYEWTPE 744 >SB_28796| Best HMM Match : LIM (HMM E-Value=5.2) Length = 625 Score = 29.1 bits (62), Expect = 3.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 227 GEWRHNKPGYEWRPE 241 >SB_47739| Best HMM Match : WCCH (HMM E-Value=3.5) Length = 932 Score = 29.1 bits (62), Expect = 3.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 533 GEWRHNKPGYEWRPE 547 >SB_2065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 619 Score = 29.1 bits (62), Expect = 3.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 253 GEWCHKKPGYEWTPE 267 >SB_55881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 874 Score = 28.7 bits (61), Expect = 4.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 498 GEWAHGPPGVKWLPEPIDI 442 G+W H PG +W PE D+ Sbjct: 457 GDWRHKKPGYEWRPEANDL 475 >SB_58867| Best HMM Match : Bombesin (HMM E-Value=2.2) Length = 423 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 271 GEWRHKKPGYEWRPE 285 >SB_56271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 456 GEWRHKKPGFEWRPE 470 >SB_56228| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 969 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 577 GEWRHKKPGYEWRPE 591 >SB_55327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 470 GEWRHKKPGYEWRPE 484 >SB_53550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1149 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 730 GEWRHKKPGYEWRPE 744 >SB_53052| Best HMM Match : U79_P34 (HMM E-Value=2.7) Length = 1130 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 760 GEWRHKKPGYEWRPE 774 >SB_53010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 787 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 761 GEWRHEKPGYEWRPE 775 >SB_50679| Best HMM Match : Tombus_P19 (HMM E-Value=2.1) Length = 330 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 155 GEWRHKKPGYEWRPE 169 >SB_48331| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 367 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 110 GEWRHKKPGYEWRPE 124 >SB_46599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4482 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 4094 GEWRHKKPGYEWRPE 4108 >SB_46403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 733 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 517 GEWRHKKPGYEWRPE 531 >SB_45754| Best HMM Match : ResIII (HMM E-Value=6.2) Length = 181 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 37 GEWRHKKPGYEWRPE 51 >SB_44664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 454 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 39 GEWRHKQPGYEWRPE 53 >SB_41497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 792 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 348 GEWRHKQPGYEWRPE 362 >SB_39466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 51 GEWRHKKPGYEWRPE 65 >SB_38850| Best HMM Match : ResIII (HMM E-Value=0.045) Length = 382 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 157 GEWRHKKPGYEWRPE 171 >SB_36475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1315 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 1000 GEWRHKKPGYEWRPE 1014 >SB_34782| Best HMM Match : zf-CHY (HMM E-Value=0.36) Length = 967 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 544 GEWRHKKPGYEWRPE 558 >SB_34067| Best HMM Match : SPAN-X (HMM E-Value=2.7) Length = 207 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 73 GEWRHKKPGYEWRPE 87 >SB_33054| Best HMM Match : DEAD (HMM E-Value=0.42) Length = 1088 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 683 GEWRHKQPGYEWRPE 697 >SB_33051| Best HMM Match : PADR1 (HMM E-Value=1.2) Length = 1066 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 535 GEWRHKKPGYEWRPE 549 >SB_30838| Best HMM Match : ResIII (HMM E-Value=0.13) Length = 327 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 37 GEWRHKKPGYEWRPE 51 >SB_29698| Best HMM Match : DUF1610 (HMM E-Value=4.6) Length = 739 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 381 GEWRHKKPGYEWRPE 395 >SB_29289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 956 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 682 GEWRHKKPGYEWRPE 696 >SB_28291| Best HMM Match : DUF1131 (HMM E-Value=2.3) Length = 421 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 253 GEWRHKKPGYEWRPE 267 >SB_27649| Best HMM Match : ResIII (HMM E-Value=0.43) Length = 802 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 573 GEWRHKKPGYEWRPE 587 >SB_25225| Best HMM Match : DEAD (HMM E-Value=1.4) Length = 534 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 299 GEWRHKKPGYEWRPE 313 >SB_23107| Best HMM Match : ResIII (HMM E-Value=0.045) Length = 418 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 193 GEWRHKKPGYEWRPE 207 >SB_22826| Best HMM Match : F5_F8_type_C (HMM E-Value=7.9e-09) Length = 1296 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 1100 GEWRHKKPGYEWRPE 1114 >SB_21356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1003 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 646 GEWRHKKPGYEWRPE 660 >SB_20530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 515 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 253 GEWRHKKPGYEWRPE 267 >SB_20292| Best HMM Match : DUF495 (HMM E-Value=3.7) Length = 895 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 783 GEWRHKKPGYEWRPE 797 >SB_19129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 918 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 666 GEWRHKKPGYEWRPE 680 >SB_17591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 567 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 400 GEWRHKKPGYEWRPE 414 >SB_14541| Best HMM Match : ResIII (HMM E-Value=0.66) Length = 822 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 470 GEWRHKKPGYEWRPE 484 >SB_13306| Best HMM Match : PADR1 (HMM E-Value=1.2) Length = 967 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 436 GEWRHKKPGYEWRPE 450 >SB_8103| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1071 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 675 GEWRHKKPGYEWRPE 689 >SB_7382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1120 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 633 GEWRHKKPGYEWRPE 647 >SB_7259| Best HMM Match : ResIII (HMM E-Value=0.21) Length = 956 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 515 GEWRHKKPGYEWRPE 529 >SB_7068| Best HMM Match : ResIII (HMM E-Value=0.29) Length = 1131 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 762 GEWRHKKPGYEWRPE 776 >SB_3900| Best HMM Match : DUF1070 (HMM E-Value=1) Length = 500 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 204 GEWRHKKPGYEWRPE 218 >SB_3753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 976 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 539 GEWRHKKPGYEWRPE 553 >SB_474| Best HMM Match : dsrm (HMM E-Value=3.2e-20) Length = 918 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 576 GEWRHKKPGYEWRPE 590 >SB_366| Best HMM Match : ResIII (HMM E-Value=0.28) Length = 1104 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 758 GEWRHKKPGYEWRPE 772 >SB_59743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 1015 GEWRHKKPGYEWRPE 1029 >SB_59334| Best HMM Match : zf-AN1 (HMM E-Value=0.72) Length = 1161 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 749 GEWRHKKPGYEWRPE 763 >SB_56589| Best HMM Match : zf-C4_Topoisom (HMM E-Value=1.1) Length = 743 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 37 GEWRHKKPGYEWRPE 51 >SB_53861| Best HMM Match : LIM (HMM E-Value=0.93) Length = 968 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 621 GEWRHKKPGYEWRPE 635 >SB_53789| Best HMM Match : ResIII (HMM E-Value=0.044) Length = 942 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 756 GEWRHKKPGYEWRPE 770 >SB_53507| Best HMM Match : DUF1610 (HMM E-Value=2) Length = 425 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 342 GEWRHKKPGYEWRPE 356 >SB_52692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 692 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 271 GEWRHKKPGYEWRPE 285 >SB_52546| Best HMM Match : ResIII (HMM E-Value=0.21) Length = 293 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 37 GEWRHKKPGYEWRPE 51 >SB_51131| Best HMM Match : ResIII (HMM E-Value=0.36) Length = 738 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 465 GEWRHKKPGYEWRPE 479 >SB_50233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 967 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 632 GEWRHKKPGYEWRPE 646 >SB_47012| Best HMM Match : ScdA_N (HMM E-Value=5.3) Length = 840 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 677 GEWRHKKPGYEWRPE 691 >SB_45084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 368 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 234 GEWRHKKPGYEWRPE 248 >SB_44503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1347 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 957 GEWRHKKPGYEWRPE 971 >SB_43547| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 408 GEWRHEKPGYEWRPE 422 >SB_42858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 953 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 701 GEWRHKKPGYEWRPE 715 >SB_41929| Best HMM Match : ResIII (HMM E-Value=1.5) Length = 773 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 544 GEWRHKKPGYEWRPE 558 >SB_39579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 490 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 380 GEWRHKKPGYEWRPE 394 >SB_36328| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1526 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 1310 GEWRHKKPGYQWRPE 1324 >SB_36310| Best HMM Match : DEAD (HMM E-Value=1.4) Length = 1042 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 662 GEWRHKKPGYEWRPE 676 >SB_35740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1069 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 618 GEWRHKKPGYEWRPE 632 >SB_31538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 676 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 253 GEWRHKKPGYEWRPE 267 >SB_29783| Best HMM Match : PA14 (HMM E-Value=5e-05) Length = 1395 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 900 GEWRHKKPGYEWRPE 914 >SB_27544| Best HMM Match : ResIII (HMM E-Value=0.14) Length = 522 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 37 GEWRHKKPGYEWRPE 51 >SB_26374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 645 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 501 GEWRHKKPGYEWRPE 515 >SB_25592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 730 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 271 GEWRHKKPGYEWRPE 285 >SB_24250| Best HMM Match : ResIII (HMM E-Value=3.6) Length = 842 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 659 GEWRHKKPGYEWRPE 673 >SB_21674| Best HMM Match : LIM (HMM E-Value=0.44) Length = 885 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 538 GEWRHKKPGYEWRPE 552 >SB_20407| Best HMM Match : ResIII (HMM E-Value=0.36) Length = 1175 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 676 GEWRHKKPGYEWRPE 690 >SB_15365| Best HMM Match : U79_P34 (HMM E-Value=1.8) Length = 992 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 661 GEWRHKKPGYEWRPE 675 >SB_13172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 599 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 253 GEWRHKKPGYEWRPE 267 >SB_11769| Best HMM Match : Complex1_17_2kD (HMM E-Value=6.6) Length = 355 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 219 GEWRHKKPGYEWRPE 233 >SB_9087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 657 GEWRHKKPGYEWRPE 671 >SB_8850| Best HMM Match : LIM (HMM E-Value=0.51) Length = 1039 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 578 GEWRHKKPGYEWRPE 592 >SB_6669| Best HMM Match : zf-C4_Topoisom (HMM E-Value=1.2) Length = 523 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 52 GEWRHKKPGYEWRPE 66 >SB_5979| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 396 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 335 GEWRHKKPGYEWRPE 349 >SB_2770| Best HMM Match : ResIII (HMM E-Value=2.2) Length = 928 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 543 GEWRHKKPGYEWRPE 557 >SB_1076| Best HMM Match : Phage_tail_S (HMM E-Value=2.7) Length = 834 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 486 GEWRHKKPGYEWRPE 500 >SB_57402| Best HMM Match : DEAD (HMM E-Value=0.42) Length = 428 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 149 GEWRHKRPGYEWRPE 163 >SB_56935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1108 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 631 GEWRHKRPGYEWRPE 645 >SB_56636| Best HMM Match : Toxin_4 (HMM E-Value=2.4) Length = 434 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 108 GEWRHKMPGYEWRPE 122 >SB_56193| Best HMM Match : RolB_RolC (HMM E-Value=5.3) Length = 337 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 247 GEWRHKRPGYEWRPE 261 >SB_56070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 779 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 272 GEWRHKRPGYEWQPE 286 >SB_50726| Best HMM Match : zf-CCHC (HMM E-Value=1.8) Length = 389 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 110 GEWRHKRPGYEWWPE 124 >SB_48939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 908 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 401 GEWRHKRPGYEWRPE 415 >SB_47810| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 149 GEWRHKRPGYEWRPE 163 >SB_45057| Best HMM Match : Rhabdo_NV (HMM E-Value=4.1) Length = 522 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 412 GEWRHKRPGYEWRPE 426 >SB_40361| Best HMM Match : ResIII (HMM E-Value=0.42) Length = 1127 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 515 GEWRHKRPGYEWRPE 529 >SB_30566| Best HMM Match : zf-C4_Topoisom (HMM E-Value=0.38) Length = 597 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 37 GEWRHKRPGYEWRPE 51 >SB_27946| Best HMM Match : DEAD (HMM E-Value=0.42) Length = 751 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 244 GEWRHKRPGYEWRPE 258 >SB_24603| Best HMM Match : GatB_Yqey (HMM E-Value=0.7) Length = 984 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 505 GEWRHKRPGYEWRPE 519 >SB_22253| Best HMM Match : Pkinase (HMM E-Value=0) Length = 870 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 746 GEWRHKRPGYEWRPE 760 >SB_17486| Best HMM Match : CheR (HMM E-Value=3.2) Length = 1177 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 762 GEWRHKRPGYEWRPE 776 >SB_15632| Best HMM Match : CBM_5_12 (HMM E-Value=2.9) Length = 748 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 658 GEWRHKRPGYEWRPE 672 >SB_9872| Best HMM Match : ResIII (HMM E-Value=0.36) Length = 624 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 149 GEWRHKRPGYEWRPE 163 >SB_9659| Best HMM Match : ResIII (HMM E-Value=0.39) Length = 333 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 130 GEWRHKRPGYEWRPE 144 >SB_5900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1023 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 653 GEWRHKRPGYEWRPE 667 >SB_4087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1095 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 658 GEWRHKRPGYEWRPE 672 >SB_3096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 994 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 569 GEWRHKRPGYEWRPE 583 >SB_59126| Best HMM Match : zf-A20 (HMM E-Value=4.4) Length = 860 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 770 GEWRHKRPGYEWRPE 784 >SB_58059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 993 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 540 GEWRHKRPGYEWRPE 554 >SB_56794| Best HMM Match : ResIII (HMM E-Value=0.63) Length = 532 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 37 GEWRHKRPGYEWRPE 51 >SB_54647| Best HMM Match : Phage_tail_S (HMM E-Value=2.4) Length = 571 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 37 GEWRHKRPGYEWRPE 51 >SB_53156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1019 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 704 GEWRHKRPGYEWRPE 718 >SB_53060| Best HMM Match : ResIII (HMM E-Value=0.14) Length = 1248 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 766 GEWRHKRPGYEWRPE 780 >SB_51306| Best HMM Match : Peptidase_C27 (HMM E-Value=0.78) Length = 645 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 596 GEWRHKRPGYEWRPE 610 >SB_48412| Best HMM Match : ResIII (HMM E-Value=0.19) Length = 1390 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 883 GEWRHKRPGYEWRPE 897 >SB_47766| Best HMM Match : Ribosomal_L27 (HMM E-Value=2.3) Length = 596 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 510 GEWRHKRPGYEWRPE 524 >SB_42053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 110 GEWRHKRPGYEWRPE 124 >SB_40200| Best HMM Match : Ribosomal_L27 (HMM E-Value=2.6) Length = 333 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 312 GEWRHKRPGYEWRPE 326 >SB_39663| Best HMM Match : ResIII (HMM E-Value=1.1) Length = 1143 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 678 GEWRHKRPGYEWRPE 692 >SB_35959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1136 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 696 GEWRHKRPGYEWRPE 710 >SB_31859| Best HMM Match : DUF1131 (HMM E-Value=4.3) Length = 455 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 393 GEWRHKRPGYEWRPE 407 >SB_31030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1009 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 593 GEWRHKRPGYEWRPE 607 >SB_27423| Best HMM Match : ResIII (HMM E-Value=0.56) Length = 562 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 247 GEWRHKRPGYEWRPE 261 >SB_27319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1099 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 596 GEWRHKRPGYEWRPE 610 >SB_27311| Best HMM Match : DEAD (HMM E-Value=0.17) Length = 1178 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 667 GEWRHKRPGYEWRPE 681 >SB_27173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1206 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 743 GEWRHKRPGYEWRPE 757 >SB_24707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 921 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 560 GEWRHKRPGYEWRPE 574 >SB_24616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 37 GEWRHKRPGYEWRPE 51 >SB_24369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 27.9 bits (59), Expect = 8.1 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 578 NNDNLDSKVAVTFQLSLYILFFIMLRWVNGLTAHLVLS 465 N+D D+K VTFQ SL+ + + N LT VLS Sbjct: 77 NDDESDNKTLVTFQPSLWPWDSVRTKLRNALTEVCVLS 114 >SB_21729| Best HMM Match : Ribosomal_L27 (HMM E-Value=5.7) Length = 268 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 247 GEWRHKRPGYEWRPE 261 >SB_15115| Best HMM Match : ResIII (HMM E-Value=0.24) Length = 1179 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 684 GEWRHKRPGYEWRPE 698 >SB_11429| Best HMM Match : Shikimate_DH (HMM E-Value=7.7) Length = 308 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 287 GEWRHKRPGYEWRPE 301 >SB_7073| Best HMM Match : ResIII (HMM E-Value=0.083) Length = 1105 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 679 GEWRHKRPGYEWRPE 693 >SB_5505| Best HMM Match : ResIII (HMM E-Value=0.55) Length = 1346 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 838 GEWRHKRPGYEWRPE 852 >SB_4780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 799 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 709 GEWRHKRPGYEWRPE 723 >SB_2121| Best HMM Match : ResIII (HMM E-Value=0.46) Length = 1106 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 706 GEWRHKRPGYEWRPE 720 >SB_1328| Best HMM Match : PHZA_PHZB (HMM E-Value=3.4) Length = 636 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 315 GEWRHKRPGYEWRPE 329 >SB_204| Best HMM Match : ResIII (HMM E-Value=1.2) Length = 244 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 498 GEWAHGPPGVKWLPE 454 GEW H PG +W PE Sbjct: 99 GEWRHKRPGYEWRPE 113 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,804,841 Number of Sequences: 59808 Number of extensions: 361536 Number of successful extensions: 737 Number of sequences better than 10.0: 144 Number of HSP's better than 10.0 without gapping: 712 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 737 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1769412099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -