BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0158 (683 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g65390.1 68414.m07420 disease resistance protein (TIR class),... 29 2.9 >At1g65390.1 68414.m07420 disease resistance protein (TIR class), putative domain signature TIR exists, suggestive of a disease resistance protein. Length = 411 Score = 29.1 bits (62), Expect = 2.9 Identities = 20/55 (36%), Positives = 24/55 (43%) Frame = -3 Query: 492 WAHGPPGVKWLPEPIDIYNINALEI*VLKSQYSYLSTISKLTVRTLRESTRLIVV 328 W+ WLP P N + +EI LKS S+L K R L TR VV Sbjct: 270 WSEDSNHWTWLPLPNQNSNESVMEIAFLKSA-SWLDVAGKFDTRYLTPRTRYEVV 323 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,674,150 Number of Sequences: 28952 Number of extensions: 251276 Number of successful extensions: 391 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 386 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 391 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1447936096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -