BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0156 (668 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 23 2.6 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 2.6 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 3.5 U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor... 22 4.6 DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. 21 8.0 AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 21 8.0 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 23.0 bits (47), Expect = 2.6 Identities = 10/29 (34%), Positives = 13/29 (44%), Gaps = 2/29 (6%) Frame = -1 Query: 611 LSPYARMAWGSAYPS*MGTV--WETPSPE 531 + PY + W S PS G + W PE Sbjct: 465 MHPYDHLVWNSWMPSIRGAIQQWTCRQPE 493 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.0 bits (47), Expect = 2.6 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 350 LRVAPEEHPVLLTEAPLNPKANREKM 427 LR+ P H V+ T +NP + EK+ Sbjct: 1461 LRLGPCWHAVMTTYPRINPDNHNEKL 1486 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.6 bits (46), Expect = 3.5 Identities = 11/42 (26%), Positives = 17/42 (40%) Frame = +3 Query: 471 SPSKPCSRCTRPVYHRYRAGLRRRCLPHRAHLRRIRTPPRHP 596 S ++ T +HR C P +L +I + P HP Sbjct: 55 SGTRSSESLTAQAHHRLYPAFSSSCDPVPGNLEQIGSRPLHP 96 >U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor protein. Length = 129 Score = 22.2 bits (45), Expect = 4.6 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -2 Query: 511 YTGRVQREHGLDGDVHGG 458 Y RV ++G+ GD +GG Sbjct: 60 YKQRVYDKNGMTGDAYGG 77 >DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. Length = 152 Score = 21.4 bits (43), Expect = 8.0 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -1 Query: 257 LFALCLISYIRV 222 LF LC++SY+ V Sbjct: 8 LFTLCIVSYMMV 19 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 21.4 bits (43), Expect = 8.0 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +3 Query: 114 GMCKAGFAGD 143 GMCK G +GD Sbjct: 130 GMCKEGISGD 139 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 212,431 Number of Sequences: 438 Number of extensions: 5269 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20221290 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -