BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0155 (639 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81473-2|CAB03898.1| 240|Caenorhabditis elegans Hypothetical pr... 29 2.8 Z81473-1|CAB03897.1| 302|Caenorhabditis elegans Hypothetical pr... 29 2.8 >Z81473-2|CAB03898.1| 240|Caenorhabditis elegans Hypothetical protein C17D12.1b protein. Length = 240 Score = 29.1 bits (62), Expect = 2.8 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = +2 Query: 404 TDSDDDYRLTNKFRHCNLLSKKNKTHAVCSRCDVTRPRVIRHSR 535 +D +D+ FRH +L +C+RCD RP H R Sbjct: 25 SDEEDESDEEAVFRHDHLNRSSATEWTMCTRCDSLRPPRAHHCR 68 >Z81473-1|CAB03897.1| 302|Caenorhabditis elegans Hypothetical protein C17D12.1a protein. Length = 302 Score = 29.1 bits (62), Expect = 2.8 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = +2 Query: 404 TDSDDDYRLTNKFRHCNLLSKKNKTHAVCSRCDVTRPRVIRHSR 535 +D +D+ FRH +L +C+RCD RP H R Sbjct: 87 SDEEDESDEEAVFRHDHLNRSSATEWTMCTRCDSLRPPRAHHCR 130 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,320,534 Number of Sequences: 27780 Number of extensions: 227603 Number of successful extensions: 486 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 471 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 486 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1416829972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -