BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0154 (654 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 134 8e-32 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 134 8e-32 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 134 8e-32 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 131 4e-31 SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 4e-23 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 3e-21 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 94 8e-20 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 94 8e-20 SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) 94 8e-20 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 94 8e-20 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 94 1e-19 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 94 1e-19 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 93 2e-19 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 5e-19 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 7e-19 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 7e-19 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 91 1e-18 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 91 1e-18 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 91 1e-18 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 91 1e-18 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 91 1e-18 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 91 1e-18 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 91 1e-18 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 91 1e-18 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 91 1e-18 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 91 1e-18 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 91 1e-18 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 91 1e-18 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 91 1e-18 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 91 1e-18 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 91 1e-18 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 91 1e-18 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 91 1e-18 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 91 1e-18 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 91 1e-18 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 91 1e-18 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 91 1e-18 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 91 1e-18 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 91 1e-18 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 91 1e-18 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 91 1e-18 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 91 1e-18 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 91 1e-18 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 91 1e-18 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 91 1e-18 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 91 1e-18 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 91 1e-18 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 91 1e-18 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 91 1e-18 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 91 1e-18 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 91 1e-18 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 91 1e-18 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 91 1e-18 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 91 1e-18 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 91 1e-18 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 91 1e-18 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 91 1e-18 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 91 1e-18 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 91 1e-18 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 91 1e-18 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 91 1e-18 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 91 1e-18 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 90 1e-18 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 90 1e-18 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 90 1e-18 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 90 1e-18 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 90 1e-18 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 90 1e-18 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 90 1e-18 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 90 1e-18 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 90 1e-18 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 90 1e-18 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 90 1e-18 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 90 1e-18 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 90 1e-18 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 90 1e-18 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 90 1e-18 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 90 1e-18 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 90 1e-18 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 90 1e-18 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 90 1e-18 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 90 1e-18 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 90 1e-18 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 90 1e-18 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 90 1e-18 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 90 1e-18 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 90 1e-18 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 90 1e-18 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 90 1e-18 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 90 1e-18 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 90 1e-18 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 90 1e-18 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 90 1e-18 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 90 1e-18 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 90 1e-18 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 90 1e-18 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 90 1e-18 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 90 1e-18 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 90 1e-18 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 90 1e-18 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 90 1e-18 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 90 1e-18 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 90 1e-18 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 90 1e-18 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 90 1e-18 SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) 90 1e-18 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 90 2e-18 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 90 2e-18 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 90 2e-18 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 90 2e-18 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 90 2e-18 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 90 2e-18 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 90 2e-18 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 90 2e-18 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 90 2e-18 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 90 2e-18 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 90 2e-18 SB_20169| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 3e-18 SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 3e-18 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 4e-18 SB_30632| Best HMM Match : Acyltransferase (HMM E-Value=0.0097) 89 4e-18 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 88 5e-18 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 88 5e-18 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 88 5e-18 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 88 5e-18 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 88 5e-18 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 88 5e-18 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 88 5e-18 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 88 5e-18 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 88 5e-18 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 88 5e-18 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 88 5e-18 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 88 5e-18 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 88 5e-18 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 88 5e-18 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 88 5e-18 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 88 5e-18 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 88 5e-18 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 88 5e-18 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 134 bits (323), Expect = 8e-32 Identities = 60/63 (95%), Positives = 60/63 (95%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGFPSHDVVKRRPVNCNTTHYR 188 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW GFPSHDVVKRRPVNCNTTHYR Sbjct: 589 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYR 645 Query: 187 ANW 179 ANW Sbjct: 646 ANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 134 bits (323), Expect = 8e-32 Identities = 60/63 (95%), Positives = 60/63 (95%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGFPSHDVVKRRPVNCNTTHYR 188 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW GFPSHDVVKRRPVNCNTTHYR Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYR 88 Query: 187 ANW 179 ANW Sbjct: 89 ANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 134 bits (323), Expect = 8e-32 Identities = 60/63 (95%), Positives = 60/63 (95%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGFPSHDVVKRRPVNCNTTHYR 188 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW GFPSHDVVKRRPVNCNTTHYR Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYR 88 Query: 187 ANW 179 ANW Sbjct: 89 ANW 91 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 131 bits (317), Expect = 4e-31 Identities = 57/59 (96%), Positives = 58/59 (98%) Frame = -3 Query: 355 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGFPSHDVVKRRPVNCNTTHYRANW 179 +LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 22 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 105 bits (251), Expect = 4e-23 Identities = 49/52 (94%), Positives = 49/52 (94%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGFPSHDVVKRRPV 212 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW GFPSHDVVKRRPV Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPV 67 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 99.1 bits (236), Expect = 3e-21 Identities = 46/60 (76%), Positives = 50/60 (83%) Frame = +3 Query: 213 TGRRFTTS*LGKPWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 TGRRFT P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 40 TGRRFTRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 99 >SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 94.3 bits (224), Expect = 8e-20 Identities = 44/60 (73%), Positives = 48/60 (80%) Frame = +3 Query: 213 TGRRFTTS*LGKPWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 TGRR P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 35 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 94 >SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 94.3 bits (224), Expect = 8e-20 Identities = 44/60 (73%), Positives = 48/60 (80%) Frame = +3 Query: 213 TGRRFTTS*LGKPWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 TGRR P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 45 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 104 >SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 94.3 bits (224), Expect = 8e-20 Identities = 44/60 (73%), Positives = 48/60 (80%) Frame = +3 Query: 213 TGRRFTTS*LGKPWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 TGRR P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 72 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 131 >SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) Length = 270 Score = 94.3 bits (224), Expect = 8e-20 Identities = 53/109 (48%), Positives = 65/109 (59%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGFPSHDVVKRRPVNCNTTHYR 188 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF RR C TT Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQ----SRR---CKTT-AS 70 Query: 187 ANWVPGPPSSGRGPFWLILVLNCLWKSREFLKGR*IGKCSELNKNNNFV 41 A S P W+++ + ++ ++F +G +N++ V Sbjct: 71 AKLACLQVDSRGSPTWVLVQADSEYQGKDFTANLTVGNLDLINESGIIV 119 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 93.9 bits (223), Expect = 1e-19 Identities = 43/55 (78%), Positives = 46/55 (83%) Frame = +3 Query: 213 TGRRFTTS*LGKPWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 377 TGRR P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 15 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 69 >SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 93.9 bits (223), Expect = 1e-19 Identities = 43/55 (78%), Positives = 46/55 (83%) Frame = +3 Query: 213 TGRRFTTS*LGKPWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 377 TGRR P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 25 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 79 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 93.1 bits (221), Expect = 2e-19 Identities = 50/102 (49%), Positives = 66/102 (64%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNILLKFALNFC*ISS 428 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L + S Sbjct: 46 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLLTHLCASTEIPRS 105 Query: 429 FFNQ*AEIGKIPYKSKE*TEIGLSVVPFGTRVHY*RTWTPTS 554 F Q + + ++ S++ + G+ V ++ T+TP S Sbjct: 106 TFTQASSVQRLFGTSQD--DAGVGVFSGNAPGNFSATFTPIS 145 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 92.3 bits (219), Expect = 3e-19 Identities = 53/117 (45%), Positives = 67/117 (57%), Gaps = 2/117 (1%) Frame = +3 Query: 48 LLFLFNSEHFPIYLPFKNSLDFHKQFKT--KISQNGPRPLEGGPGTQFAL**VVLQFTGR 221 + + NS P + K L F++ K+ +IS +G R + G + L Sbjct: 1 MTMITNSSSVPPFARLKIGLQFYQGLKSVSRISSSGVRQMASGDPLESTCRHASLALAVV 60 Query: 222 RFTTS*LGKPWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 61 LQRRD-WENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 116 >SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 91.5 bits (217), Expect = 5e-19 Identities = 52/80 (65%), Positives = 52/80 (65%), Gaps = 2/80 (2%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGFPSHDVVKRRPVNCNTTHYR 188 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF RR C TT Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQ----SRR---CKTTASA 71 Query: 187 --ANWVPGPPSSGRGPFWLI 134 A S R PFW I Sbjct: 72 KLACLQVDSRGSPRKPFWFI 91 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 91.1 bits (216), Expect = 7e-19 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVN 386 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ N Sbjct: 1075 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRQN 1120 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 1063 LAVVLQRRDWENPGVTQLNRLAAHP 1087 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 91.1 bits (216), Expect = 7e-19 Identities = 49/68 (72%), Positives = 50/68 (73%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGFPSHDVVKRRPVNCNTTHYR 188 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF RR C TT Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQ----SRR---CKTT--- 53 Query: 187 ANWVPGPP 164 A+ PG P Sbjct: 54 ASEFPGDP 61 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 368 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 97 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 136 Score = 38.7 bits (86), Expect = 0.004 Identities = 21/49 (42%), Positives = 27/49 (55%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTASEL*YDSL 192 GR++ A + + G + + PGFSQSRRCKTTASE D L Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEFPGDPL 62 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHP 109 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 472 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 512 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 483 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 523 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 44 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTASEL 207 GR++ A + + G + + PGFSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 90.6 bits (215), Expect = 1e-18 Identities = 41/53 (77%), Positives = 45/53 (84%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNILLKFAL 407 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L L Sbjct: 845 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLLTHLIL 897 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 833 LAVVLQRRDWENPGVTQLNRLAAHP 857 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 216 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 256 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTASEL 207 GR++ A + + G + + PGFSQSRRCKTTASEL Sbjct: 227 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 269 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 38.3 bits (85), Expect = 0.005 Identities = 25/72 (34%), Positives = 36/72 (50%), Gaps = 1/72 (1%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS-EL*YDSL*GELGTGPPL 162 GR++ A + + G + + PGFSQSRRCKTTAS +L + PP Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPFPPD 88 Query: 161 ERPRTVLANFGL 126 +RP +NF + Sbjct: 89 DRPYRFTSNFSV 100 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 65 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 105 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 76 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 116 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 646 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 686 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 657 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 697 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 371 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 411 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTASEL 207 GR++ A + + G + + PGFSQSRRCKTTASEL Sbjct: 382 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 424 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 287 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 327 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTASEL 207 GR++ A + + G + + PGFSQSRRCKTTASEL Sbjct: 298 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 340 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 555 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 595 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 566 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 606 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 179 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 219 Score = 86.2 bits (204), Expect = 2e-17 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 255 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 368 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 529 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 566 Score = 34.3 bits (75), Expect = 0.088 Identities = 17/41 (41%), Positives = 23/41 (56%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTA 216 GR++ A + + G + + PGFSQSRRCKTTA Sbjct: 190 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 229 Score = 33.5 bits (73), Expect = 0.15 Identities = 16/25 (64%), Positives = 17/25 (68%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWEN G+ L L P Sbjct: 515 LAVVLQRRDWENTGVTQLNRLAAHP 539 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 44 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTASEL 207 GR++ A + + G + + PGFSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 44 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTASEL 207 GR++ A + + G + + PGFSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 44 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTASEL 207 GR++ A + + G + + PGFSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 27 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 67 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTASEL 207 GR++ A + + G + + PGFSQSRRCKTTASEL Sbjct: 38 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 80 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 72 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 43 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 83 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 11 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 51 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 22 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 261 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 301 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTASEL 207 GR++ A + + G + + PGFSQSRRCKTTASEL Sbjct: 272 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 314 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.5 bits (83), Expect = 0.009 Identities = 26/71 (36%), Positives = 35/71 (49%), Gaps = 4/71 (5%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTASE----L*YDSL*GELGTG 171 GR++ A + + G + + PGFSQSRRCKTTAS L DS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPCVRS 88 Query: 170 PPLERPRTVLA 138 P+++ TVLA Sbjct: 89 CPMDKQSTVLA 99 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 188 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 228 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 199 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 239 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 445 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 485 Score = 41.5 bits (93), Expect = 6e-04 Identities = 24/61 (39%), Positives = 34/61 (55%) Frame = -2 Query: 389 NINAYNLPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTASE 210 N+ A + PF ++ GR++ A + + G + + PGFSQSRRCKTTASE Sbjct: 440 NMGASHSPFRLRNCWE-GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 497 Query: 209 L 207 L Sbjct: 498 L 498 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) Length = 144 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 280 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 320 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTASEL 207 GR++ A + + G + + PGFSQSRRCKTTASEL Sbjct: 291 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 333 >SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) Length = 199 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 130 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 170 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTASEL 207 GR++ A + + G + + PGFSQSRRCKTTASEL Sbjct: 141 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 183 >SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) Length = 206 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 44 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTASEL 207 GR++ A + + G + + PGFSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) Length = 164 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) Length = 130 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) Length = 206 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1411 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) Length = 1106 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 914 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 954 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 925 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 965 >SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 44 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTASEL 207 GR++ A + + G + + PGFSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) Length = 195 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 581 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 621 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTASEL 207 GR++ A + + G + + PGFSQSRRCKTTASEL Sbjct: 592 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 634 >SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) Length = 140 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) Length = 800 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 262 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 302 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 273 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 313 >SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) Length = 110 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) Length = 157 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 495 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 535 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTASEL 207 GR++ A + + G + + PGFSQSRRCKTTASEL Sbjct: 506 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 548 >SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) Length = 271 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 179 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 219 Score = 39.9 bits (89), Expect = 0.002 Identities = 23/60 (38%), Positives = 33/60 (55%) Frame = -2 Query: 386 INAYNLPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTASEL 207 + A + PF ++ GR++ A + + G + + PGFSQSRRCKTTASEL Sbjct: 175 VGASHSPFRLRNCWE-GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 232 >SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) Length = 766 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) Length = 188 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) Length = 118 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 81.4 bits (192), Expect = 6e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 369 AIRHSGCATVGKGDRCGPLRYYASWRKGDVLQGD 268 AIRHSGCATVGKGDRCGPLRYYASWRKGDVLQGD Sbjct: 85 AIRHSGCATVGKGDRCGPLRYYASWRKGDVLQGD 118 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 68 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 108 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 79 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 119 >SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 90.6 bits (215), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 367 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGF 245 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -2 Query: 338 GRAIGAGLFAITPAGERGMCCKAIKLGNPGFSQSRRCKTTAS 213 GR++ A + + G + + PGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 74 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 121 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHP 86 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 37 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 84 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHP 49 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 61 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 108 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHP 73 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 40 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 87 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHP 52 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 126 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 173 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHP 138 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 51 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 98 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHP 63 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 23 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 70 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHP 35 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 100 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 147 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHP 112 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 34 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 81 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHP 46 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 165 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 212 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 153 LAVVLQRRDWENPGVTQLNRLAAHP 177 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 69 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 116 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHP 81 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 59 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 106 Score = 34.3 bits (75), Expect = 0.088 Identities = 16/25 (64%), Positives = 17/25 (68%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 L VVLQRRDWENPG+ L L P Sbjct: 47 LDVVLQRRDWENPGVTQLNRLAAHP 71 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 72 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 119 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHP 84 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 225 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 272 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 213 LAVVLQRRDWENPGVTQLNRLAAHP 237 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 60 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 107 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHP 72 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 52 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 99 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHP 64 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 87 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 134 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 75 LAVVLQRRDWENPGVTQLNRLAAHP 99 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 34 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 81 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHP 46 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 69 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 116 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHP 81 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNILLK 398 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ + K Sbjct: 112 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRRQVRAK 161 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHP 124 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 85 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 132 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 40 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 87 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHP 52 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 71 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 118 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHP 83 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 100 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 147 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHP 112 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 112 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 159 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHP 124 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 44 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 91 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHP 56 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 137 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 184 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 125 LAVVLQRRDWENPGVTQLNRLAAHP 149 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 108 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 155 Score = 39.1 bits (87), Expect = 0.003 Identities = 24/62 (38%), Positives = 32/62 (51%), Gaps = 2/62 (3%) Frame = +1 Query: 109 TSTNNSRPKLAK--TVRGRSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGLPNLIALQH 282 T+ +NS P + ++ +RG P+ LAVVLQRRDWENPG+ L L Sbjct: 61 TTRHNSLPNTTRHNSLHNSTRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAA 118 Query: 283 IP 288 P Sbjct: 119 HP 120 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 73 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 120 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 61 LAVVLQRRDWENPGVTQLNRLAAHP 85 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 96 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 143 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHP 108 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 96 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 143 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHP 108 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 96 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 143 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHP 108 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 77 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 124 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHP 89 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 36 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 83 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHP 48 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 120 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 167 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 108 LAVVLQRRDWENPGVTQLNRLAAHP 132 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 36 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 83 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHP 48 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 55 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 102 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHP 67 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 88 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 135 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 76 LAVVLQRRDWENPGVTQLNRLAAHP 100 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 79 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 126 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHP 91 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 103 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 150 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 91 LAVVLQRRDWENPGVTQLNRLAAHP 115 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 53 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 100 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHP 65 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 146 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 193 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHP 158 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 194 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 241 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 182 LAVVLQRRDWENPGVTQLNRLAAHP 206 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 71 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 118 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHP 83 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 158 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 205 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 146 LAVVLQRRDWENPGVTQLNRLAAHP 170 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 70 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 117 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHP 82 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 128 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 175 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 116 LAVVLQRRDWENPGVTQLNRLAAHP 140 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 35 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 82 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 23 LAVVLQRRDWENPGVTQLNRLAAHP 47 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 664 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 711 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 652 LAVVLQRRDWENPGVTQLNRLAAHP 676 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 51 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 98 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHP 63 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 173 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 220 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHP 185 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 34 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 81 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHP 46 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 82 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 129 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHP 94 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 83 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 130 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 71 LAVVLQRRDWENPGVTQLNRLAAHP 95 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 91 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 138 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHP 103 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 197 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 244 Score = 39.1 bits (87), Expect = 0.003 Identities = 24/57 (42%), Positives = 29/57 (50%) Frame = +1 Query: 118 NNSRPKLAKTVRGRSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGLPNLIALQHIP 288 +NS +L + RS G P+ LAVVLQRRDWENPG+ L L P Sbjct: 155 DNSAEQLDHHLSHRSHGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHP 209 >SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) Length = 633 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 456 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 503 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 444 LAVVLQRRDWENPGVTQLNRLAAHP 468 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 85 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 132 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 278 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 325 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 266 LAVVLQRRDWENPGVTQLNRLAAHP 290 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 46 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 93 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 82 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 129 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHP 94 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 116 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 163 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHP 128 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 75 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 122 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHP 87 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 85 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 132 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 85 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 132 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 86 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 133 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 74 LAVVLQRRDWENPGVTQLNRLAAHP 98 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 95 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 142 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHP 107 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 188 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 235 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 176 LAVVLQRRDWENPGVTQLNRLAAHP 200 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 43 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 90 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHP 55 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 95 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 142 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHP 107 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 61 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 108 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHP 73 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 80 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 127 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHP 92 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 81 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 128 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHP 93 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 50 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 97 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHP 62 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 56 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 103 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHP 68 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 74 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 121 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHP 86 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 93 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 140 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHP 105 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 99 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 146 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 87 LAVVLQRRDWENPGVTQLNRLAAHP 111 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 116 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 163 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHP 128 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 50 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 97 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHP 62 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 62 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 109 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHP 74 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 61 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 108 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHP 73 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 138 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 185 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 126 LAVVLQRRDWENPGVTQLNRLAAHP 150 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 81 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 128 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHP 93 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 67 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 114 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHP 79 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 66 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 113 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHP 78 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 100 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 147 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHP 112 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 67 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 114 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHP 79 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 106 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 153 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 94 LAVVLQRRDWENPGVTQLNRLAAHP 118 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 77 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 124 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHP 89 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 179 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 226 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 167 LAVVLQRRDWENPGVTQLNRLAAHP 191 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 91 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 138 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHP 103 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 69 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 116 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHP 81 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 117 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 164 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 105 LAVVLQRRDWENPGVTQLNRLAAHP 129 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 48 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 95 Score = 38.3 bits (85), Expect = 0.005 Identities = 24/58 (41%), Positives = 28/58 (48%) Frame = +1 Query: 115 TNNSRPKLAKTVRGRSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGLPNLIALQHIP 288 +N R L + R RG P+ LAVVLQRRDWENPG+ L L P Sbjct: 5 SNTWRILLRNDRKSRHRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHP 60 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 131 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 178 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 119 LAVVLQRRDWENPGVTQLNRLAAHP 143 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 164 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 211 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 152 LAVVLQRRDWENPGVTQLNRLAAHP 176 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 114 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 161 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 102 LAVVLQRRDWENPGVTQLNRLAAHP 126 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 46 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 93 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 49 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 96 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHP 61 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 81 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 128 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHP 93 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 138 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 185 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 126 LAVVLQRRDWENPGVTQLNRLAAHP 150 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 38 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 85 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHP 50 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 83 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 130 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 71 LAVVLQRRDWENPGVTQLNRLAAHP 95 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 97 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 144 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHP 109 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 105 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 152 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHP 117 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 84 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 131 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 72 LAVVLQRRDWENPGVTQLNRLAAHP 96 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 105 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 152 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHP 117 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 119 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 166 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 107 LAVVLQRRDWENPGVTQLNRLAAHP 131 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 93 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 140 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHP 105 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 120 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 167 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 108 LAVVLQRRDWENPGVTQLNRLAAHP 132 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 318 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 365 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 306 LAVVLQRRDWENPGVTQLNRLAAHP 330 >SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 64 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 111 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 52 LAVVLQRRDWENPGVTQLNRLAAHP 76 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 27 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 74 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 15 LAVVLQRRDWENPGVTQLNRLAAHP 39 >SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 38 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 85 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHP 50 >SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 68 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 115 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHP 80 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 259 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 306 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 247 LAVVLQRRDWENPGVTQLNRLAAHP 271 >SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 93 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 140 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHP 105 >SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 60 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 107 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHP 72 >SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 36 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 83 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHP 48 >SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 216 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 263 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 204 LAVVLQRRDWENPGVTQLNRLAAHP 228 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 75 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 122 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHP 87 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 731 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 778 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 719 LAVVLQRRDWENPGVTQLNRLAAHP 743 >SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 51 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 98 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHP 63 >SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 551 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 199 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 246 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 187 LAVVLQRRDWENPGVTQLNRLAAHP 211 >SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) Length = 511 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 127 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 174 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 115 LAVVLQRRDWENPGVTQLNRLAAHP 139 >SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 42 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 89 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 30 LAVVLQRRDWENPGVTQLNRLAAHP 54 >SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 32 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 79 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHP 44 >SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 97 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 144 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHP 109 >SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 44 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 91 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHP 56 >SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 121 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 168 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 109 LAVVLQRRDWENPGVTQLNRLAAHP 133 >SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 33 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 80 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHP 45 >SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 49 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 96 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHP 61 >SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 72 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 119 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHP 84 >SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 33 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 80 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHP 45 >SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 53 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 100 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHP 65 >SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 79 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 126 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHP 91 >SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 56 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 103 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHP 68 >SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 74 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 121 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHP 86 >SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) Length = 191 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 133 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 180 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 121 LAVVLQRRDWENPGVTQLNRLAAHP 145 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 81 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 128 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHP 93 >SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) Length = 940 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 376 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 423 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 364 LAVVLQRRDWENPGVTQLNRLAAHP 388 >SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) Length = 267 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 53 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 100 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHP 65 >SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) Length = 144 Score = 90.2 bits (214), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 249 PWVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 392 P VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 66 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 113 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 214 LAVVLQRRDWENPGLPNLIALQHIP 288 LAVVLQRRDWENPG+ L L P Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHP 78 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,714,552 Number of Sequences: 59808 Number of extensions: 501488 Number of successful extensions: 8166 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5139 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8134 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -