BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0154 (654 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. 25 1.6 AY146723-1|AAO12083.1| 155|Anopheles gambiae odorant-binding pr... 24 3.7 AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase ... 23 6.4 >AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. Length = 189 Score = 25.4 bits (53), Expect = 1.6 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -3 Query: 193 YRANWVPGPPSSGRGPFWL 137 +R W P PP GR P+WL Sbjct: 92 FRPPWHPRPPFGGR-PWWL 109 >AY146723-1|AAO12083.1| 155|Anopheles gambiae odorant-binding protein AgamOBP17 protein. Length = 155 Score = 24.2 bits (50), Expect = 3.7 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = -3 Query: 376 TICHSPFRLRNCWEGRSVRASSLLRQL 296 T+C F L CW+ + + LR++ Sbjct: 121 TLCDKAFWLHKCWKQSDPKVNMALRRI 147 >AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase protein. Length = 849 Score = 23.4 bits (48), Expect = 6.4 Identities = 13/51 (25%), Positives = 23/51 (45%) Frame = +3 Query: 6 RRRRDGGHIKGKTKLLFLFNSEHFPIYLPFKNSLDFHKQFKTKISQNGPRP 158 +R+ +K LL L HF + P N+ D H+ + + + P+P Sbjct: 667 KRKNASPSLKEDNSLLSLIG--HFFLQTPIPNNGDVHQGGDSNHTSSSPKP 715 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 759,174 Number of Sequences: 2352 Number of extensions: 16148 Number of successful extensions: 21 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -