BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0154 (654 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g15070.1 68416.m01906 zinc finger (C3HC4-type RING finger) fa... 28 6.2 At2g41990.1 68415.m05194 expressed protein 27 8.2 >At3g15070.1 68416.m01906 zinc finger (C3HC4-type RING finger) family protein similar to C-terminal zinc-finger [Glycine max] GI:558543; contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 486 Score = 27.9 bits (59), Expect = 6.2 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +3 Query: 543 TPTSKGEKPSIRAMAHYVNHHP 608 T +S+ PS+ HY++HHP Sbjct: 260 TSSSRNPTPSVYQRNHYISHHP 281 >At2g41990.1 68415.m05194 expressed protein Length = 297 Score = 27.5 bits (58), Expect = 8.2 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = +1 Query: 22 GDTSKEKQNCYFY---LIPSIFLFTYLLKILWTSTNNSRPKLAKTVRG 156 GD +N Y L+ IFLFT ILW ++ + PK+ TV+G Sbjct: 103 GDDDDPFRNVRLYVWLLLSVIFLFTVFSLILWGASKSYPPKV--TVKG 148 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,875,238 Number of Sequences: 28952 Number of extensions: 349822 Number of successful extensions: 781 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 761 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 781 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -