BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0153 (663 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 130 1e-30 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 130 1e-30 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 130 1e-30 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 122 3e-28 SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 7e-22 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 4e-17 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 4e-17 SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 4e-17 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 8e-17 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 8e-17 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 84 8e-17 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 82 5e-16 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 81 6e-16 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 81 6e-16 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 81 6e-16 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 81 6e-16 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 81 6e-16 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 81 6e-16 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 81 6e-16 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 81 6e-16 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 81 6e-16 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 81 6e-16 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 81 6e-16 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 81 6e-16 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 81 6e-16 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 81 6e-16 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 81 6e-16 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 81 6e-16 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 81 6e-16 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 81 6e-16 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 81 6e-16 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 81 6e-16 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 81 6e-16 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 81 6e-16 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 81 6e-16 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 81 6e-16 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 81 6e-16 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 81 6e-16 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 81 6e-16 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 81 6e-16 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 81 6e-16 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 81 6e-16 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 81 6e-16 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 81 6e-16 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 81 6e-16 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 81 6e-16 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 81 6e-16 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 81 6e-16 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 81 6e-16 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 81 6e-16 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_31286| Best HMM Match : HEAT (HMM E-Value=0.092) 81 6e-16 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 81 6e-16 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 81 6e-16 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 81 6e-16 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 81 6e-16 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 81 6e-16 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 81 6e-16 SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) 81 6e-16 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 81 8e-16 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 81 8e-16 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 81 8e-16 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 81 8e-16 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 81 8e-16 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 81 8e-16 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 81 8e-16 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 81 8e-16 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 81 8e-16 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 81 8e-16 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 81 8e-16 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 81 8e-16 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 81 8e-16 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 81 8e-16 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 81 8e-16 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 81 8e-16 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 81 8e-16 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 81 8e-16 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 81 8e-16 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 81 8e-16 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 81 8e-16 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 81 8e-16 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 81 8e-16 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 81 8e-16 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 81 8e-16 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 81 8e-16 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 81 8e-16 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 81 8e-16 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 81 8e-16 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 81 8e-16 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 81 8e-16 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 81 8e-16 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 81 8e-16 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 81 8e-16 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 81 8e-16 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 81 8e-16 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 81 8e-16 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 81 8e-16 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 81 8e-16 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 81 8e-16 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 81 8e-16 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 81 8e-16 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 81 8e-16 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 81 8e-16 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 81 8e-16 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 81 8e-16 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 81 1e-15 SB_39908| Best HMM Match : Prismane (HMM E-Value=3) 81 1e-15 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 80 1e-15 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 80 1e-15 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 80 1e-15 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 80 1e-15 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 80 1e-15 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 80 1e-15 SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 80 1e-15 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 80 1e-15 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 80 1e-15 SB_20169| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_30809| Best HMM Match : Mab-21 (HMM E-Value=0) 80 2e-15 SB_19785| Best HMM Match : SRR1 (HMM E-Value=8.8e-19) 80 2e-15 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 79 3e-15 SB_27913| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 79 3e-15 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_23924| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_14096| Best HMM Match : DUF595 (HMM E-Value=2.1) 79 3e-15 SB_3195| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_58700| Best HMM Match : Ras (HMM E-Value=2.7e-15) 79 4e-15 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 79 4e-15 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 79 4e-15 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 79 4e-15 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 79 4e-15 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 79 4e-15 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 79 4e-15 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 79 4e-15 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 79 4e-15 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 79 4e-15 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 79 4e-15 SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 79 4e-15 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 79 4e-15 SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) 79 4e-15 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 79 4e-15 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 79 4e-15 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 79 4e-15 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 79 4e-15 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 130 bits (313), Expect = 1e-30 Identities = 58/63 (92%), Positives = 59/63 (93%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGFPSHDVVKRRPVNCNTTHYR 435 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GFPSHDVVKRRPVNCNTTHYR Sbjct: 589 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYR 645 Query: 434 ANW 426 ANW Sbjct: 646 ANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 130 bits (313), Expect = 1e-30 Identities = 58/63 (92%), Positives = 59/63 (93%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGFPSHDVVKRRPVNCNTTHYR 435 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GFPSHDVVKRRPVNCNTTHYR Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYR 88 Query: 434 ANW 426 ANW Sbjct: 89 ANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 130 bits (313), Expect = 1e-30 Identities = 58/63 (92%), Positives = 59/63 (93%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGFPSHDVVKRRPVNCNTTHYR 435 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GFPSHDVVKRRPVNCNTTHYR Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYR 88 Query: 434 ANW 426 ANW Sbjct: 89 ANW 91 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 122 bits (293), Expect = 3e-28 Identities = 53/59 (89%), Positives = 55/59 (93%) Frame = -2 Query: 602 RLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGFPSHDVVKRRPVNCNTTHYRANW 426 +LRNCW+GRSVRA SLLRQLAKGGCAARRLSW GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 22 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 101 bits (241), Expect = 7e-22 Identities = 47/52 (90%), Positives = 48/52 (92%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGFPSHDVVKRRPV 459 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GFPSHDVVKRRPV Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPV 67 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 90.2 bits (214), Expect = 1e-18 Identities = 43/61 (70%), Positives = 49/61 (80%) Frame = +1 Query: 460 TGRRFTTS*LGKPWRYQLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYF 639 TGRRFT P QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF Sbjct: 40 TGRRFTRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYF 97 Query: 640 V 642 + Sbjct: 98 L 98 >SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 85.4 bits (202), Expect = 4e-17 Identities = 41/61 (67%), Positives = 47/61 (77%) Frame = +1 Query: 460 TGRRFTTS*LGKPWRYQLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYF 639 TGRR P QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF Sbjct: 35 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYF 92 Query: 640 V 642 + Sbjct: 93 L 93 >SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 85.4 bits (202), Expect = 4e-17 Identities = 41/61 (67%), Positives = 47/61 (77%) Frame = +1 Query: 460 TGRRFTTS*LGKPWRYQLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYF 639 TGRR P QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF Sbjct: 45 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYF 102 Query: 640 V 642 + Sbjct: 103 L 103 >SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 85.4 bits (202), Expect = 4e-17 Identities = 41/61 (67%), Positives = 47/61 (77%) Frame = +1 Query: 460 TGRRFTTS*LGKPWRYQLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYF 639 TGRR P QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF Sbjct: 72 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYF 129 Query: 640 V 642 + Sbjct: 130 L 130 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 84.2 bits (199), Expect = 8e-17 Identities = 39/55 (70%), Positives = 43/55 (78%) Frame = +1 Query: 460 TGRRFTTS*LGKPWRYQLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIV 624 TGRR P QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW+++ Sbjct: 15 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 69 >SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 84.2 bits (199), Expect = 8e-17 Identities = 39/55 (70%), Positives = 43/55 (78%) Frame = +1 Query: 460 TGRRFTTS*LGKPWRYQLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIV 624 TGRR P QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW+++ Sbjct: 25 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 79 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 84.2 bits (199), Expect = 8e-17 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFVKI 648 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW+++ +Y + + Sbjct: 545 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRARYTITL 591 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 529 LAVVLQRRDWENPGVTQLNRLAAHP 553 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = -1 Query: 618 LPFAIQAAQLLERAIGAGLFAITPAGERGMCCKAIKLVTPGF 493 +PFAIQAAQLL RAIGAGLFAITPAGERGMCCKAIKLVTP F Sbjct: 1836 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLVTPVF 1877 Score = 59.3 bits (137), Expect = 3e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 494 FPSHDVVKRRPVNCNTTHYRANW 426 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 1877 FPSHDVVKRRPVNCNTTHYRANW 1899 >SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) Length = 132 Score = 81.8 bits (193), Expect = 5e-16 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVK 633 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW+++ K Sbjct: 67 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRTK 108 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHP 75 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 78 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 120 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHP 86 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 41 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 83 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHP 49 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 65 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 107 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHP 73 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 44 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 86 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHP 52 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 849 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 891 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 833 LAVVLQRRDWENPGVTQLNRLAAHP 857 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 130 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 172 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHP 138 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 55 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 97 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHP 63 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 27 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 69 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHP 35 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 104 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 146 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHP 112 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 38 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 80 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHP 46 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 169 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 211 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 153 LAVVLQRRDWENPGVTQLNRLAAHP 177 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 73 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 115 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHP 81 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 63 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 105 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 L VVLQRRDWENPGVT L L P Sbjct: 47 LDVVLQRRDWENPGVTQLNRLAAHP 71 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 76 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 118 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHP 84 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 229 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 271 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 213 LAVVLQRRDWENPGVTQLNRLAAHP 237 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 64 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 106 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHP 72 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 56 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 98 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHP 64 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 91 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 133 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 75 LAVVLQRRDWENPGVTQLNRLAAHP 99 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 38 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 80 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHP 46 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 73 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 115 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHP 81 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 89 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 131 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 44 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 86 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHP 52 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 75 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 117 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHP 83 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 104 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 146 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHP 112 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 116 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 158 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHP 124 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 48 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 90 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHP 56 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 141 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 183 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 125 LAVVLQRRDWENPGVTQLNRLAAHP 149 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 112 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 154 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 96 LAVVLQRRDWENPGVTQLNRLAAHP 120 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 77 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 119 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 61 LAVVLQRRDWENPGVTQLNRLAAHP 85 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 100 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 142 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHP 108 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 100 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 142 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHP 108 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 100 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 142 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHP 108 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 81 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 123 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHP 89 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 40 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 82 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHP 48 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 124 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 166 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 108 LAVVLQRRDWENPGVTQLNRLAAHP 132 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 40 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 82 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHP 48 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 59 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 101 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHP 67 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 92 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 134 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 76 LAVVLQRRDWENPGVTQLNRLAAHP 100 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 83 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 125 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHP 91 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 107 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 149 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 91 LAVVLQRRDWENPGVTQLNRLAAHP 115 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 57 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 99 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHP 65 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 150 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 192 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHP 158 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 198 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 240 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 182 LAVVLQRRDWENPGVTQLNRLAAHP 206 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 75 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 117 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHP 83 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 162 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 204 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 146 LAVVLQRRDWENPGVTQLNRLAAHP 170 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 74 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 116 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHP 82 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 132 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 174 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 116 LAVVLQRRDWENPGVTQLNRLAAHP 140 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 39 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 81 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 23 LAVVLQRRDWENPGVTQLNRLAAHP 47 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 668 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 710 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 652 LAVVLQRRDWENPGVTQLNRLAAHP 676 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 55 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 97 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHP 63 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 177 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 219 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHP 185 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 38 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 80 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHP 46 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 86 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 128 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHP 94 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 87 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 129 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 71 LAVVLQRRDWENPGVTQLNRLAAHP 95 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 95 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 137 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHP 103 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 201 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 243 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 185 LAVVLQRRDWENPGVTQLNRLAAHP 209 >SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) Length = 633 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 460 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 502 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 444 LAVVLQRRDWENPGVTQLNRLAAHP 468 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 89 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 131 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 282 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 324 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 266 LAVVLQRRDWENPGVTQLNRLAAHP 290 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 50 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 92 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 81.4 bits (192), Expect = 6e-16 Identities = 45/68 (66%), Positives = 47/68 (69%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGFPSHDVVKRRPVNCNTTHYR 435 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF RR C TT Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQ----SRR---CKTT--- 53 Query: 434 ANWVPGPP 411 A+ PG P Sbjct: 54 ASEFPGDP 61 Score = 78.6 bits (185), Expect = 4e-15 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEW 615 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW Sbjct: 101 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 136 Score = 42.7 bits (96), Expect = 3e-04 Identities = 20/32 (62%), Positives = 22/32 (68%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTASEL*YDSL 439 G + + VTPGFSQSRRCKTTASE D L Sbjct: 31 GCAARRLSWVTPGFSQSRRCKTTASEFPGDPL 62 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHP 109 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 86 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 128 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHP 94 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 120 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 162 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHP 128 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 79 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 121 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHP 87 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 89 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 131 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 89 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 131 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 90 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 132 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 74 LAVVLQRRDWENPGVTQLNRLAAHP 98 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 99 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 141 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHP 107 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 192 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 234 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 176 LAVVLQRRDWENPGVTQLNRLAAHP 200 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 47 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 89 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHP 55 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 99 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 141 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHP 107 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 65 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 107 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHP 73 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 84 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 126 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHP 92 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 73 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 115 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHP 81 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 85 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 127 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHP 93 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 54 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 96 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHP 62 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 60 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 102 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHP 68 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 78 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 120 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHP 86 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 97 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 139 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHP 105 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 103 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 145 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 87 LAVVLQRRDWENPGVTQLNRLAAHP 111 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 120 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 162 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHP 128 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 54 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 96 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHP 62 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 66 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 108 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHP 74 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 65 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 107 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHP 73 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 142 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 184 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 126 LAVVLQRRDWENPGVTQLNRLAAHP 150 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 85 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 127 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHP 93 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 71 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 113 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHP 79 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 70 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 112 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHP 78 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 104 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 146 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHP 112 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 71 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 113 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHP 79 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 110 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 152 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 94 LAVVLQRRDWENPGVTQLNRLAAHP 118 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 81 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 123 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHP 89 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 183 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 225 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 167 LAVVLQRRDWENPGVTQLNRLAAHP 191 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 95 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 137 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHP 103 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 73 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 115 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHP 81 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 121 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 163 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 105 LAVVLQRRDWENPGVTQLNRLAAHP 129 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 52 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 94 Score = 40.7 bits (91), Expect = 0.001 Identities = 23/46 (50%), Positives = 25/46 (54%) Frame = +2 Query: 398 RGRSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTNLIALQHIP 535 + R RG P+ LAVVLQRRDWENPGVT L L P Sbjct: 17 KSRHRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHP 60 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 135 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 177 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 119 LAVVLQRRDWENPGVTQLNRLAAHP 143 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 168 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 210 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 152 LAVVLQRRDWENPGVTQLNRLAAHP 176 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 118 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 160 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 102 LAVVLQRRDWENPGVTQLNRLAAHP 126 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 50 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 92 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 53 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 95 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHP 61 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 85 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 127 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHP 93 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 142 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 184 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 126 LAVVLQRRDWENPGVTQLNRLAAHP 150 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 42 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 84 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHP 50 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 87 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 129 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 71 LAVVLQRRDWENPGVTQLNRLAAHP 95 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 101 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 143 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHP 109 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 109 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 151 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHP 117 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 88 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 130 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 72 LAVVLQRRDWENPGVTQLNRLAAHP 96 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 109 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 151 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHP 117 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 123 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 165 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 107 LAVVLQRRDWENPGVTQLNRLAAHP 131 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 97 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 139 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHP 105 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 124 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 166 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 108 LAVVLQRRDWENPGVTQLNRLAAHP 132 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 322 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 364 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 306 LAVVLQRRDWENPGVTQLNRLAAHP 330 >SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 68 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 110 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 52 LAVVLQRRDWENPGVTQLNRLAAHP 76 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 31 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 73 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 15 LAVVLQRRDWENPGVTQLNRLAAHP 39 >SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 42 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 84 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHP 50 >SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 72 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 114 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHP 80 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 263 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 305 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 247 LAVVLQRRDWENPGVTQLNRLAAHP 271 >SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 97 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 139 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHP 105 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 50 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 92 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 64 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 106 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHP 72 >SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 40 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 82 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHP 48 >SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 220 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 262 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 204 LAVVLQRRDWENPGVTQLNRLAAHP 228 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 79 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 121 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHP 87 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 735 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 777 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 719 LAVVLQRRDWENPGVTQLNRLAAHP 743 >SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 55 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 97 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHP 63 >SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 551 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 203 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 245 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 187 LAVVLQRRDWENPGVTQLNRLAAHP 211 >SB_31286| Best HMM Match : HEAT (HMM E-Value=0.092) Length = 1270 Score = 81.4 bits (192), Expect = 6e-16 Identities = 39/52 (75%), Positives = 44/52 (84%) Frame = -1 Query: 618 LPFAIQAAQLLERAIGAGLFAITPAGERGMCCKAIKLVTPGFSQSRRCKTTA 463 +PFAIQAAQLL RAIGAGLFAITPAGERGMCCKAIKL TP ++R+ T+ Sbjct: 1122 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLDTPSSPRARKFGETS 1173 >SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) Length = 511 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 131 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 173 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 115 LAVVLQRRDWENPGVTQLNRLAAHP 139 >SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 46 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 88 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 30 LAVVLQRRDWENPGVTQLNRLAAHP 54 >SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 36 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 78 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHP 44 >SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 101 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 143 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHP 109 >SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 48 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 90 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHP 56 >SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 125 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 167 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 109 LAVVLQRRDWENPGVTQLNRLAAHP 133 >SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 37 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 79 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHP 45 >SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 53 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 95 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHP 61 >SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 76 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 118 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHP 84 >SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 37 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 79 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHP 45 >SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 57 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 99 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHP 65 >SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 83 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 125 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHP 91 >SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 60 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 102 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHP 68 >SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 78 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 120 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHP 86 >SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) Length = 191 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 137 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 179 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 121 LAVVLQRRDWENPGVTQLNRLAAHP 145 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 85 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 127 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHP 93 >SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) Length = 940 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 380 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 422 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 364 LAVVLQRRDWENPGVTQLNRLAAHP 388 >SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) Length = 267 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 57 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 99 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHP 65 >SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) Length = 144 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 70 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 112 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHP 78 >SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) Length = 630 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEWQIVSVKYFV 642 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW++ ++YF+ Sbjct: 453 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL--MRYFL 495 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWENPGVT L L P Sbjct: 437 LAVVLQRRDWENPGVTQLNRLAAHP 461 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 472 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 512 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 499 GCAARRLSWVTPGFSQSRRCKTTAS 523 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 44 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTASEL 454 G + + VTPGFSQSRRCKTTASEL Sbjct: 31 GCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 216 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 256 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTASEL 454 G + + VTPGFSQSRRCKTTASEL Sbjct: 243 GCAARRLSWVTPGFSQSRRCKTTASEL 269 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 65 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 105 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 92 GCAARRLSWVTPGFSQSRRCKTTAS 116 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 646 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 686 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 673 GCAARRLSWVTPGFSQSRRCKTTAS 697 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 371 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 411 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTASEL 454 G + + VTPGFSQSRRCKTTASEL Sbjct: 398 GCAARRLSWVTPGFSQSRRCKTTASEL 424 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 287 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 327 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTASEL 454 G + + VTPGFSQSRRCKTTASEL Sbjct: 314 GCAARRLSWVTPGFSQSRRCKTTASEL 340 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 555 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 595 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 582 GCAARRLSWVTPGFSQSRRCKTTAS 606 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 179 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 219 Score = 78.6 bits (185), Expect = 4e-15 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +1 Query: 508 QLNRLAAHPPFASWRNSEKARTDRPFQQLRSLNGEW 615 QLNRLAAHPPFASWRNSE+ARTDRP QQLRSLNGEW Sbjct: 531 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 566 Score = 38.3 bits (85), Expect = 0.006 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTA 463 G + + VTPGFSQSRRCKTTA Sbjct: 206 GCAARRLSWVTPGFSQSRRCKTTA 229 Score = 37.1 bits (82), Expect = 0.013 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +2 Query: 461 LAVVLQRRDWENPGVTNLIALQHIP 535 LAVVLQRRDWEN GVT L L P Sbjct: 515 LAVVLQRRDWENTGVTQLNRLAAHP 539 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 44 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTASEL 454 G + + VTPGFSQSRRCKTTASEL Sbjct: 31 GCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 44 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTASEL 454 G + + VTPGFSQSRRCKTTASEL Sbjct: 31 GCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 44 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTASEL 454 G + + VTPGFSQSRRCKTTASEL Sbjct: 31 GCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 27 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 67 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTASEL 454 G + + VTPGFSQSRRCKTTASEL Sbjct: 54 GCAARRLSWVTPGFSQSRRCKTTASEL 80 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 72 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 59 GCAARRLSWVTPGFSQSRRCKTTAS 83 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 11 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 51 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 38 GCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 261 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 301 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTASEL 454 G + + VTPGFSQSRRCKTTASEL Sbjct: 288 GCAARRLSWVTPGFSQSRRCKTTASEL 314 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 188 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 228 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 215 GCAARRLSWVTPGFSQSRRCKTTAS 239 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 445 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 485 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTASEL 454 G + + VTPGFSQSRRCKTTASEL Sbjct: 472 GCAARRLSWVTPGFSQSRRCKTTASEL 498 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) Length = 144 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 280 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 320 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTASEL 454 G + + VTPGFSQSRRCKTTASEL Sbjct: 307 GCAARRLSWVTPGFSQSRRCKTTASEL 333 >SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) Length = 199 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 130 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 170 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTASEL 454 G + + VTPGFSQSRRCKTTASEL Sbjct: 157 GCAARRLSWVTPGFSQSRRCKTTASEL 183 >SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) Length = 206 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 44 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTASEL 454 G + + VTPGFSQSRRCKTTASEL Sbjct: 31 GCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) Length = 164 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) Length = 130 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) Length = 206 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1411 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) Length = 1106 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 914 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 954 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 941 GCAARRLSWVTPGFSQSRRCKTTAS 965 >SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 44 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTASEL 454 G + + VTPGFSQSRRCKTTASEL Sbjct: 31 GCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) Length = 195 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 581 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 621 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTASEL 454 G + + VTPGFSQSRRCKTTASEL Sbjct: 608 GCAARRLSWVTPGFSQSRRCKTTASEL 634 >SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) Length = 140 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) Length = 270 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) Length = 800 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 262 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 302 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 289 GCAARRLSWVTPGFSQSRRCKTTAS 313 >SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) Length = 110 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) Length = 157 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 495 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 535 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTASEL 454 G + + VTPGFSQSRRCKTTASEL Sbjct: 522 GCAARRLSWVTPGFSQSRRCKTTASEL 548 >SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) Length = 271 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 179 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 219 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTASEL 454 G + + VTPGFSQSRRCKTTASEL Sbjct: 206 GCAARRLSWVTPGFSQSRRCKTTASEL 232 >SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) Length = 766 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) Length = 188 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) Length = 118 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 79.8 bits (188), Expect = 2e-15 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -3 Query: 616 AIRHSGCATVGKGDRCGPFRYYASWRKGDVLQGD 515 AIRHSGCATVGKGDRCGP RYYASWRKGDVLQGD Sbjct: 85 AIRHSGCATVGKGDRCGPLRYYASWRKGDVLQGD 118 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 614 HSPFRLRNCWKGRSVRAFSLLRQLAKGGCAARRLSW*RQGF 492 HSPFRLRNCW+GRSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 534 GMCCKAIKLVTPGFSQSRRCKTTAS 460 G + + VTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,477,554 Number of Sequences: 59808 Number of extensions: 401487 Number of successful extensions: 8160 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5176 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8115 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1705624125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -