BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0152 (599 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC29A3.01 |||heavy metal ATPase |Schizosaccharomyces pombe|chr... 29 0.39 SPAC19G12.16c |adg2|SPAC23A1.01c, mug46|conserved fungal protein... 28 0.91 SPCC1223.06 |tea1|alp8|cell end marker Tea1|Schizosaccharomyces ... 27 2.1 SPBC12D12.04c |pck2|sts6, pkc1|protein kinase C |Schizosaccharom... 26 4.8 SPBC1604.01 |mug158|SPBC1677.01c|sulfatase modifying factor 1 re... 25 6.4 SPCC1223.03c |gut2||glycerol-3-phosphate dehydrogenase Gut2|Schi... 25 8.5 >SPBC29A3.01 |||heavy metal ATPase |Schizosaccharomyces pombe|chr 2|||Manual Length = 904 Score = 29.5 bits (63), Expect = 0.39 Identities = 18/46 (39%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +2 Query: 185 PAQSGVF-PWRQMLNEMWTSTVQRIRLLSSSHRLHIVLCLRVWRRP 319 P G F PW LN MW S + SS L L LR W++P Sbjct: 813 PIAMGFFLPWGIYLNPMWASAAM---MFSSLSVLASSLLLRRWKKP 855 >SPAC19G12.16c |adg2|SPAC23A1.01c, mug46|conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 670 Score = 28.3 bits (60), Expect = 0.91 Identities = 18/58 (31%), Positives = 25/58 (43%), Gaps = 1/58 (1%) Frame = -1 Query: 179 CRERSEAARHSVNTANVKSASAL*DL-IVKAHRSRSLGNSTQHLHSSSHHRRIVHEKT 9 C R E +V+T + S S I + S +L +T HL SSS H H + Sbjct: 579 CSSRPEETISTVSTTSTVSESGSSSASITSTYPSSTLSMTTSHLSSSSVHSSSAHSSS 636 >SPCC1223.06 |tea1|alp8|cell end marker Tea1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1147 Score = 27.1 bits (57), Expect = 2.1 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 246 SRGFGYYPHPTDCTLYYVCVFGGALLE 326 +R G Y H C +C+FGG LL+ Sbjct: 183 ARPSGRYGHTISCLGSKICLFGGRLLD 209 >SPBC12D12.04c |pck2|sts6, pkc1|protein kinase C |Schizosaccharomyces pombe|chr 2|||Manual Length = 1016 Score = 25.8 bits (54), Expect = 4.8 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = -1 Query: 101 IVKAHRSRSLGNSTQHLHSSSHHRRIVHEKTR 6 ++ R+ + + QH SSHH+ H+K++ Sbjct: 533 VISEIRTTKIYKAQQHKQKSSHHKHHHHKKSK 564 >SPBC1604.01 |mug158|SPBC1677.01c|sulfatase modifying factor 1 related|Schizosaccharomyces pombe|chr 2|||Manual Length = 773 Score = 25.4 bits (53), Expect = 6.4 Identities = 16/43 (37%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = +3 Query: 90 CLYDEVLQRTRAFYVSRVDRMP--CRLRPFAASIRPSQECSRG 212 C YD VL+RT YVS + +L P A S S + G Sbjct: 658 CFYDRVLERTDEPYVSTEGKATGFQQLHPLALSDNSSNQIFTG 700 >SPCC1223.03c |gut2||glycerol-3-phosphate dehydrogenase Gut2|Schizosaccharomyces pombe|chr 3|||Manual Length = 649 Score = 25.0 bits (52), Expect = 8.5 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -2 Query: 367 VWSSWLYISPPVHDSSRAPPNT 302 V S+W I P V D S PP T Sbjct: 395 VLSAWCGIRPLVRDPSTVPPGT 416 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,321,695 Number of Sequences: 5004 Number of extensions: 43583 Number of successful extensions: 111 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 111 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 262236260 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -