BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0152 (599 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U29615-1|AAC50246.1| 466|Homo sapiens chitotriosidase precursor... 40 0.007 BC105682-1|AAI05683.1| 466|Homo sapiens chitinase 1 (chitotrios... 40 0.007 BC105681-1|AAI05682.1| 466|Homo sapiens chitinase 1 (chitotrios... 40 0.007 BC105680-1|AAI05681.1| 466|Homo sapiens chitinase 1 (chitotrios... 40 0.007 BC069614-1|AAH69614.1| 454|Homo sapiens CHIT1 protein protein. 40 0.007 BC103695-1|AAI03696.1| 466|Homo sapiens chitinase 1 (chitotrios... 40 0.009 AY911311-1|AAX81434.1| 315|Homo sapiens chitinase family protei... 33 1.0 BC139920-1|AAI39921.1| 407|Homo sapiens CHIA protein protein. 32 1.3 BC139901-1|AAI39902.1| 407|Homo sapiens CHIA protein protein. 32 1.3 AY911310-1|AAX81433.1| 315|Homo sapiens chitinase family protei... 32 1.3 AB025009-1|BAA86981.1| 315|Homo sapiens novel member of chitina... 32 1.3 AB025008-1|BAA86980.1| 368|Homo sapiens novel member of chitina... 32 1.3 BC106910-1|AAI06911.1| 368|Homo sapiens chitinase, acidic protein. 31 2.3 BC047336-1|AAH47336.2| 368|Homo sapiens chitinase, acidic protein. 31 2.3 BC036339-1|AAH36339.2| 368|Homo sapiens chitinase, acidic protein. 31 2.3 AY825504-1|AAX54833.1| 430|Homo sapiens chitinase family protei... 31 2.3 AY789445-1|AAX81432.1| 315|Homo sapiens chitinase family protei... 31 2.3 AY789444-1|AAX81431.1| 368|Homo sapiens chitinase family protei... 31 2.3 AL513202-5|CAH70804.1| 405|Homo sapiens eosinophil chemotactic ... 31 2.3 AL513202-4|CAH70803.1| 476|Homo sapiens eosinophil chemotactic ... 31 2.3 AL513202-3|CAH70802.1| 420|Homo sapiens eosinophil chemotactic ... 31 2.3 AL356387-9|CAI19266.1| 405|Homo sapiens eosinophil chemotactic ... 31 2.3 AL356387-8|CAI19265.1| 476|Homo sapiens eosinophil chemotactic ... 31 2.3 AL356387-6|CAI19263.1| 420|Homo sapiens eosinophil chemotactic ... 31 2.3 AF290004-1|AAG60019.1| 476|Homo sapiens acidic mammalian chitin... 31 2.3 BC040516-1|AAH40516.1| 859|Homo sapiens SGIP1 protein protein. 29 9.4 AL356913-3|CAI22673.1| 631|Homo sapiens SH3-domain GRB2-like (e... 29 9.4 AL356913-2|CAI22674.1| 828|Homo sapiens SH3-domain GRB2-like (e... 29 9.4 AL356913-1|CAI22672.1| 859|Homo sapiens SH3-domain GRB2-like (e... 29 9.4 AL354978-7|CAH71847.1| 631|Homo sapiens SH3-domain GRB2-like (e... 29 9.4 AL354978-6|CAH71846.1| 828|Homo sapiens SH3-domain GRB2-like (e... 29 9.4 AL354978-5|CAH71845.1| 859|Homo sapiens SH3-domain GRB2-like (e... 29 9.4 AL139147-4|CAI21944.1| 631|Homo sapiens SH3-domain GRB2-like (e... 29 9.4 AL139147-3|CAI21943.1| 828|Homo sapiens SH3-domain GRB2-like (e... 29 9.4 AL139147-2|CAI21942.1| 859|Homo sapiens SH3-domain GRB2-like (e... 29 9.4 AB210039-1|BAE06121.1| 856|Homo sapiens DKFZp761D221 variant pr... 29 9.4 >U29615-1|AAC50246.1| 466|Homo sapiens chitotriosidase precursor protein. Length = 466 Score = 39.9 bits (89), Expect = 0.007 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +3 Query: 258 GYYPHPTDCTLYYVCVFGGALLESCTGGLMYSHELQTCDW 377 G YP+P + + +Y C G +SC GL++S+ + C W Sbjct: 426 GLYPNPRERSSFYSCAAGRLFQQSCPTGLVFSNSCKCCTW 465 >BC105682-1|AAI05683.1| 466|Homo sapiens chitinase 1 (chitotriosidase) protein. Length = 466 Score = 39.9 bits (89), Expect = 0.007 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +3 Query: 258 GYYPHPTDCTLYYVCVFGGALLESCTGGLMYSHELQTCDW 377 G YP+P + + +Y C G +SC GL++S+ + C W Sbjct: 426 GLYPNPRERSSFYSCAAGRLFQQSCPTGLVFSNSCKCCTW 465 >BC105681-1|AAI05682.1| 466|Homo sapiens chitinase 1 (chitotriosidase) protein. Length = 466 Score = 39.9 bits (89), Expect = 0.007 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +3 Query: 258 GYYPHPTDCTLYYVCVFGGALLESCTGGLMYSHELQTCDW 377 G YP+P + + +Y C G +SC GL++S+ + C W Sbjct: 426 GLYPNPRERSSFYSCAAGRLFQQSCPTGLVFSNSCKCCTW 465 >BC105680-1|AAI05681.1| 466|Homo sapiens chitinase 1 (chitotriosidase) protein. Length = 466 Score = 39.9 bits (89), Expect = 0.007 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +3 Query: 258 GYYPHPTDCTLYYVCVFGGALLESCTGGLMYSHELQTCDW 377 G YP+P + + +Y C G +SC GL++S+ + C W Sbjct: 426 GLYPNPRERSSFYSCAAGRLFQQSCPTGLVFSNSCKCCTW 465 >BC069614-1|AAH69614.1| 454|Homo sapiens CHIT1 protein protein. Length = 454 Score = 39.9 bits (89), Expect = 0.007 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +3 Query: 258 GYYPHPTDCTLYYVCVFGGALLESCTGGLMYSHELQTCDW 377 G YP+P + + +Y C G +SC GL++S+ + C W Sbjct: 414 GLYPNPRERSSFYSCAAGRLFQQSCPTGLVFSNSCKCCTW 453 >BC103695-1|AAI03696.1| 466|Homo sapiens chitinase 1 (chitotriosidase) protein. Length = 466 Score = 39.5 bits (88), Expect = 0.009 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +3 Query: 258 GYYPHPTDCTLYYVCVFGGALLESCTGGLMYSHELQTCDW 377 G YP+P + + +Y C G +SC GL++S+ + C W Sbjct: 426 GLYPNPRERSSFYSCAGGRLFQQSCPTGLVFSNSCKCCTW 465 >AY911311-1|AAX81434.1| 315|Homo sapiens chitinase family protein V2 protein. Length = 315 Score = 32.7 bits (71), Expect = 1.0 Identities = 13/48 (27%), Positives = 22/48 (45%) Frame = +3 Query: 234 GLRLSRGFGYYPHPTDCTLYYVCVFGGALLESCTGGLMYSHELQTCDW 377 G R G YP ++ ++ CV G ++C GL++ C+W Sbjct: 267 GFCAGRANGLYPVASNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 314 >BC139920-1|AAI39921.1| 407|Homo sapiens CHIA protein protein. Length = 407 Score = 32.3 bits (70), Expect = 1.3 Identities = 13/48 (27%), Positives = 21/48 (43%) Frame = +3 Query: 234 GLRLSRGFGYYPHPTDCTLYYVCVFGGALLESCTGGLMYSHELQTCDW 377 G R G YP + ++ CV G ++C GL++ C+W Sbjct: 359 GFCAGRANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 406 >BC139901-1|AAI39902.1| 407|Homo sapiens CHIA protein protein. Length = 407 Score = 32.3 bits (70), Expect = 1.3 Identities = 13/48 (27%), Positives = 21/48 (43%) Frame = +3 Query: 234 GLRLSRGFGYYPHPTDCTLYYVCVFGGALLESCTGGLMYSHELQTCDW 377 G R G YP + ++ CV G ++C GL++ C+W Sbjct: 359 GFCAGRANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 406 >AY911310-1|AAX81433.1| 315|Homo sapiens chitinase family protein V1 protein. Length = 315 Score = 32.3 bits (70), Expect = 1.3 Identities = 13/48 (27%), Positives = 21/48 (43%) Frame = +3 Query: 234 GLRLSRGFGYYPHPTDCTLYYVCVFGGALLESCTGGLMYSHELQTCDW 377 G R G YP + ++ CV G ++C GL++ C+W Sbjct: 267 GFCAGRANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 314 >AB025009-1|BAA86981.1| 315|Homo sapiens novel member of chitinase family protein. Length = 315 Score = 32.3 bits (70), Expect = 1.3 Identities = 13/48 (27%), Positives = 21/48 (43%) Frame = +3 Query: 234 GLRLSRGFGYYPHPTDCTLYYVCVFGGALLESCTGGLMYSHELQTCDW 377 G R G YP + ++ CV G ++C GL++ C+W Sbjct: 267 GFCAGRANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 314 >AB025008-1|BAA86980.1| 368|Homo sapiens novel member of chitinase family protein. Length = 368 Score = 32.3 bits (70), Expect = 1.3 Identities = 13/48 (27%), Positives = 21/48 (43%) Frame = +3 Query: 234 GLRLSRGFGYYPHPTDCTLYYVCVFGGALLESCTGGLMYSHELQTCDW 377 G R G YP + ++ CV G ++C GL++ C+W Sbjct: 320 GFCAGRANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 367 >BC106910-1|AAI06911.1| 368|Homo sapiens chitinase, acidic protein. Length = 368 Score = 31.5 bits (68), Expect = 2.3 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = +3 Query: 249 RGFGYYPHPTDCTLYYVCVFGGALLESCTGGLMYSHELQTCDW 377 R G YP + ++ CV G ++C GL++ C+W Sbjct: 325 RANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 367 >BC047336-1|AAH47336.2| 368|Homo sapiens chitinase, acidic protein. Length = 368 Score = 31.5 bits (68), Expect = 2.3 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = +3 Query: 249 RGFGYYPHPTDCTLYYVCVFGGALLESCTGGLMYSHELQTCDW 377 R G YP + ++ CV G ++C GL++ C+W Sbjct: 325 RANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 367 >BC036339-1|AAH36339.2| 368|Homo sapiens chitinase, acidic protein. Length = 368 Score = 31.5 bits (68), Expect = 2.3 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = +3 Query: 249 RGFGYYPHPTDCTLYYVCVFGGALLESCTGGLMYSHELQTCDW 377 R G YP + ++ CV G ++C GL++ C+W Sbjct: 325 RANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 367 >AY825504-1|AAX54833.1| 430|Homo sapiens chitinase family protein 3 protein. Length = 430 Score = 31.5 bits (68), Expect = 2.3 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = +3 Query: 249 RGFGYYPHPTDCTLYYVCVFGGALLESCTGGLMYSHELQTCDW 377 R G YP + ++ CV G ++C GL++ C+W Sbjct: 387 RANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 429 >AY789445-1|AAX81432.1| 315|Homo sapiens chitinase family protein 2 protein. Length = 315 Score = 31.5 bits (68), Expect = 2.3 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = +3 Query: 249 RGFGYYPHPTDCTLYYVCVFGGALLESCTGGLMYSHELQTCDW 377 R G YP + ++ CV G ++C GL++ C+W Sbjct: 272 RANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 314 >AY789444-1|AAX81431.1| 368|Homo sapiens chitinase family protein 1 protein. Length = 368 Score = 31.5 bits (68), Expect = 2.3 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = +3 Query: 249 RGFGYYPHPTDCTLYYVCVFGGALLESCTGGLMYSHELQTCDW 377 R G YP + ++ CV G ++C GL++ C+W Sbjct: 325 RANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 367 >AL513202-5|CAH70804.1| 405|Homo sapiens eosinophil chemotactic cytokine (CHIA) protein. Length = 405 Score = 31.5 bits (68), Expect = 2.3 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = +3 Query: 249 RGFGYYPHPTDCTLYYVCVFGGALLESCTGGLMYSHELQTCDW 377 R G YP + ++ CV G ++C GL++ C+W Sbjct: 362 RANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 404 >AL513202-4|CAH70803.1| 476|Homo sapiens eosinophil chemotactic cytokine (CHIA) protein. Length = 476 Score = 31.5 bits (68), Expect = 2.3 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = +3 Query: 249 RGFGYYPHPTDCTLYYVCVFGGALLESCTGGLMYSHELQTCDW 377 R G YP + ++ CV G ++C GL++ C+W Sbjct: 433 RANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 475 >AL513202-3|CAH70802.1| 420|Homo sapiens eosinophil chemotactic cytokine (CHIA) protein. Length = 420 Score = 31.5 bits (68), Expect = 2.3 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = +3 Query: 249 RGFGYYPHPTDCTLYYVCVFGGALLESCTGGLMYSHELQTCDW 377 R G YP + ++ CV G ++C GL++ C+W Sbjct: 377 RANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 419 >AL356387-9|CAI19266.1| 405|Homo sapiens eosinophil chemotactic cytokine (CHIA) protein. Length = 405 Score = 31.5 bits (68), Expect = 2.3 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = +3 Query: 249 RGFGYYPHPTDCTLYYVCVFGGALLESCTGGLMYSHELQTCDW 377 R G YP + ++ CV G ++C GL++ C+W Sbjct: 362 RANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 404 >AL356387-8|CAI19265.1| 476|Homo sapiens eosinophil chemotactic cytokine (CHIA) protein. Length = 476 Score = 31.5 bits (68), Expect = 2.3 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = +3 Query: 249 RGFGYYPHPTDCTLYYVCVFGGALLESCTGGLMYSHELQTCDW 377 R G YP + ++ CV G ++C GL++ C+W Sbjct: 433 RANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 475 >AL356387-6|CAI19263.1| 420|Homo sapiens eosinophil chemotactic cytokine (CHIA) protein. Length = 420 Score = 31.5 bits (68), Expect = 2.3 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = +3 Query: 249 RGFGYYPHPTDCTLYYVCVFGGALLESCTGGLMYSHELQTCDW 377 R G YP + ++ CV G ++C GL++ C+W Sbjct: 377 RANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 419 >AF290004-1|AAG60019.1| 476|Homo sapiens acidic mammalian chitinase precursor protein. Length = 476 Score = 31.5 bits (68), Expect = 2.3 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = +3 Query: 249 RGFGYYPHPTDCTLYYVCVFGGALLESCTGGLMYSHELQTCDW 377 R G YP + ++ CV G ++C GL++ C+W Sbjct: 433 RANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 475 >BC040516-1|AAH40516.1| 859|Homo sapiens SGIP1 protein protein. Length = 859 Score = 29.5 bits (63), Expect = 9.4 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -2 Query: 418 PPPALAPSQPTLR-GQSHVWSSWLYISPPVHDSSRAP 311 PPP PS+P L G+ V SPP+H SS P Sbjct: 491 PPPPRPPSRPKLPPGKPGVGDVSRPFSPPIHSSSPPP 527 >AL356913-3|CAI22673.1| 631|Homo sapiens SH3-domain GRB2-like (endophilin) interacting protein 1 protein. Length = 631 Score = 29.5 bits (63), Expect = 9.4 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -2 Query: 418 PPPALAPSQPTLR-GQSHVWSSWLYISPPVHDSSRAP 311 PPP PS+P L G+ V SPP+H SS P Sbjct: 261 PPPPRPPSRPKLPPGKPGVGDVSRPFSPPIHSSSPPP 297 >AL356913-2|CAI22674.1| 828|Homo sapiens SH3-domain GRB2-like (endophilin) interacting protein 1 protein. Length = 828 Score = 29.5 bits (63), Expect = 9.4 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -2 Query: 418 PPPALAPSQPTLR-GQSHVWSSWLYISPPVHDSSRAP 311 PPP PS+P L G+ V SPP+H SS P Sbjct: 460 PPPPRPPSRPKLPPGKPGVGDVSRPFSPPIHSSSPPP 496 >AL356913-1|CAI22672.1| 859|Homo sapiens SH3-domain GRB2-like (endophilin) interacting protein 1 protein. Length = 859 Score = 29.5 bits (63), Expect = 9.4 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -2 Query: 418 PPPALAPSQPTLR-GQSHVWSSWLYISPPVHDSSRAP 311 PPP PS+P L G+ V SPP+H SS P Sbjct: 491 PPPPRPPSRPKLPPGKPGVGDVSRPFSPPIHSSSPPP 527 >AL354978-7|CAH71847.1| 631|Homo sapiens SH3-domain GRB2-like (endophilin) interacting protein 1 protein. Length = 631 Score = 29.5 bits (63), Expect = 9.4 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -2 Query: 418 PPPALAPSQPTLR-GQSHVWSSWLYISPPVHDSSRAP 311 PPP PS+P L G+ V SPP+H SS P Sbjct: 261 PPPPRPPSRPKLPPGKPGVGDVSRPFSPPIHSSSPPP 297 >AL354978-6|CAH71846.1| 828|Homo sapiens SH3-domain GRB2-like (endophilin) interacting protein 1 protein. Length = 828 Score = 29.5 bits (63), Expect = 9.4 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -2 Query: 418 PPPALAPSQPTLR-GQSHVWSSWLYISPPVHDSSRAP 311 PPP PS+P L G+ V SPP+H SS P Sbjct: 460 PPPPRPPSRPKLPPGKPGVGDVSRPFSPPIHSSSPPP 496 >AL354978-5|CAH71845.1| 859|Homo sapiens SH3-domain GRB2-like (endophilin) interacting protein 1 protein. Length = 859 Score = 29.5 bits (63), Expect = 9.4 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -2 Query: 418 PPPALAPSQPTLR-GQSHVWSSWLYISPPVHDSSRAP 311 PPP PS+P L G+ V SPP+H SS P Sbjct: 491 PPPPRPPSRPKLPPGKPGVGDVSRPFSPPIHSSSPPP 527 >AL139147-4|CAI21944.1| 631|Homo sapiens SH3-domain GRB2-like (endophilin) interacting protein 1 protein. Length = 631 Score = 29.5 bits (63), Expect = 9.4 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -2 Query: 418 PPPALAPSQPTLR-GQSHVWSSWLYISPPVHDSSRAP 311 PPP PS+P L G+ V SPP+H SS P Sbjct: 261 PPPPRPPSRPKLPPGKPGVGDVSRPFSPPIHSSSPPP 297 >AL139147-3|CAI21943.1| 828|Homo sapiens SH3-domain GRB2-like (endophilin) interacting protein 1 protein. Length = 828 Score = 29.5 bits (63), Expect = 9.4 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -2 Query: 418 PPPALAPSQPTLR-GQSHVWSSWLYISPPVHDSSRAP 311 PPP PS+P L G+ V SPP+H SS P Sbjct: 460 PPPPRPPSRPKLPPGKPGVGDVSRPFSPPIHSSSPPP 496 >AL139147-2|CAI21942.1| 859|Homo sapiens SH3-domain GRB2-like (endophilin) interacting protein 1 protein. Length = 859 Score = 29.5 bits (63), Expect = 9.4 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -2 Query: 418 PPPALAPSQPTLR-GQSHVWSSWLYISPPVHDSSRAP 311 PPP PS+P L G+ V SPP+H SS P Sbjct: 491 PPPPRPPSRPKLPPGKPGVGDVSRPFSPPIHSSSPPP 527 >AB210039-1|BAE06121.1| 856|Homo sapiens DKFZp761D221 variant protein protein. Length = 856 Score = 29.5 bits (63), Expect = 9.4 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -2 Query: 418 PPPALAPSQPTLR-GQSHVWSSWLYISPPVHDSSRAP 311 PPP PS+P L G+ V SPP+H SS P Sbjct: 488 PPPPRPPSRPKLPPGKPGVGDVSRPFSPPIHSSSPPP 524 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 87,381,390 Number of Sequences: 237096 Number of extensions: 1880979 Number of successful extensions: 4195 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 3979 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4191 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6297951520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -