BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0151 (656 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_04_0450 - 17847676-17847841,17848024-17848131,17848223-178483... 28 7.5 08_01_0390 + 3441439-3441675 28 7.5 >11_04_0450 - 17847676-17847841,17848024-17848131,17848223-17848377, 17848471-17848560,17848650-17848748,17848862-17848928, 17849028-17849124,17849357-17849492,17849579-17849634, 17849718-17849801,17849909-17850125 Length = 424 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -1 Query: 575 LKWVNCMNAKYVRYFYIGVII 513 LKW CM AK V Y+Y G+++ Sbjct: 274 LKW-KCMEAKAVAYYYHGLVL 293 >08_01_0390 + 3441439-3441675 Length = 78 Score = 27.9 bits (59), Expect = 7.5 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 222 PLPSIVC*CMFSLIGILEIRFVFPRVY*IF 311 P+ + VC C F+LIGI + VF Y F Sbjct: 42 PICADVCACFFTLIGIAAVVLVFVLAYKCF 71 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,452,241 Number of Sequences: 37544 Number of extensions: 251750 Number of successful extensions: 353 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 351 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 353 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1644004708 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -