BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0151 (656 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 23 3.4 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 22 4.5 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 5.9 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 22.6 bits (46), Expect = 3.4 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +3 Query: 189 VIMSISVTKAPPLPSIVC*CMFSLIGILEIRFVF 290 V++S PPL +IV + S++ + R+VF Sbjct: 321 VVISAGADAYPPLAAIVLGAIGSIVFYIISRYVF 354 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 22.2 bits (45), Expect = 4.5 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +3 Query: 345 YFSALKSSSVAGL--NIHSALIFIFRDNKIRASNIA 446 Y +KS+ L ++H L F + D +++ SNIA Sbjct: 46 YIYTIKSNMAKTLQFDVHMMLQFRYLDARLKFSNIA 81 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.8 bits (44), Expect = 5.9 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +3 Query: 360 KSSSVAGLNIHSALIFIFRDNKIRASNIAIH 452 KS V +N LIF + ASNI +H Sbjct: 415 KSGKVDVINAAKELIFQIANELEDASNIPVH 445 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,787 Number of Sequences: 438 Number of extensions: 3095 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -