BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0149 (719 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK023787-1|BAB14678.1| 858|Homo sapiens protein ( Homo sapiens ... 31 5.5 >AK023787-1|BAB14678.1| 858|Homo sapiens protein ( Homo sapiens cDNA FLJ13725 fis, clone PLACE3000009, weakly similar to DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT (EC 2.7.7.6). ). Length = 858 Score = 30.7 bits (66), Expect = 5.5 Identities = 20/67 (29%), Positives = 27/67 (40%) Frame = +1 Query: 88 HTQTQKLGLQTPPG*TSHIQKIQEPFIDKPPKLQNTLLLTARHSTHPTVAKERSDLSPAL 267 HT T T P +H + P P +L+ TA THPT + SP L Sbjct: 256 HTSTSPTHTPTSP---THKTSMSPPTTTSPTPSGMSLVQTATSPTHPTTSPTHPTTSPIL 312 Query: 268 VWLSTVT 288 + +S T Sbjct: 313 INVSPST 319 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 98,824,125 Number of Sequences: 237096 Number of extensions: 2094707 Number of successful extensions: 5683 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 5461 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5683 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8455186714 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -