BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0148 (650 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 26 0.31 AM712903-1|CAN84642.1| 148|Tribolium castaneum hypothetical pro... 23 2.9 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 6.7 DQ855503-1|ABH88190.1| 124|Tribolium castaneum chemosensory pro... 21 8.8 AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 21 8.8 AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein p... 21 8.8 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 21 8.8 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 25.8 bits (54), Expect = 0.31 Identities = 17/75 (22%), Positives = 30/75 (40%) Frame = -1 Query: 296 GNENEQRYTASKEPGSIQTEEQIEKARKNREGYQPTQNINKKSMSEKSIAEEKHEDFVQR 117 G++ E R +PG T EQ + + PTQ +++ E S + + VQ Sbjct: 393 GSQEESRVLDLSKPGCSYTGEQKSRRKGPAFKVDPTQVESEEEDEETSTTVFSNVEVVQE 452 Query: 116 NESRHSDLTNTSTIK 72 + +N + K Sbjct: 453 EAKKEESDSNNNNNK 467 >AM712903-1|CAN84642.1| 148|Tribolium castaneum hypothetical protein protein. Length = 148 Score = 22.6 bits (46), Expect = 2.9 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 202 PSRFLRAFSICSSVCIDPGSLLAVY 276 P RF+R F+IC +D SL + Y Sbjct: 93 PDRFVRQFTICFD-DVDLNSLYSSY 116 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.4 bits (43), Expect = 6.7 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = -2 Query: 577 YGQRFAESQKNQI 539 YG+R + S++NQI Sbjct: 450 YGRRLSNSERNQI 462 >DQ855503-1|ABH88190.1| 124|Tribolium castaneum chemosensory protein 17 protein. Length = 124 Score = 21.0 bits (42), Expect = 8.8 Identities = 10/38 (26%), Positives = 21/38 (55%) Frame = -1 Query: 230 IEKARKNREGYQPTQNINKKSMSEKSIAEEKHEDFVQR 117 +EK + EG + ++I +E + EKH++ V++ Sbjct: 47 LEKGKCTPEGEELKKDIPDALQNECAKCNEKHKEGVRK 84 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 21.0 bits (42), Expect = 8.8 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = -2 Query: 622 LDRRPTNFILRNHAGYGQRFAESQKNQII 536 LD +NF NH Y + + + +N ++ Sbjct: 88 LDYGNSNFPPINHQNYNEPYQRTHENMLL 116 >AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein protein. Length = 210 Score = 21.0 bits (42), Expect = 8.8 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = -2 Query: 622 LDRRPTNFILRNHAGYGQRFAESQKNQII 536 LD +NF NH Y + + + +N ++ Sbjct: 88 LDYGNSNFPPINHQNYNEPYQRTHENMLL 116 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 21.0 bits (42), Expect = 8.8 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = -2 Query: 622 LDRRPTNFILRNHAGYGQRFAESQKNQII 536 LD +NF NH Y + + + +N ++ Sbjct: 88 LDYGNSNFPPINHQNYNEPYQRTHENMLL 116 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,803 Number of Sequences: 336 Number of extensions: 3167 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -